(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1192

AL596167.LIN1192     Location/Qualifiers
FT   CDS             240347..240610
FT                   /transl_table=11
FT                   /gene="lin1192"
FT                   /note="similar to B. subtilis YshA protein"
FT                   /db_xref="GOA:Q92CH9"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH9"
FT                   /protein_id="CAC96423.1"
FT                   /translation="MANERNKVVTTIYGREYTIVGVETADHLRKVARQVDEKMHEIGSQ
FT                   NHALDSGRLAVLTAVNATHDYLKLEQKYLELEQELARIKGRD"
     MANERNKVVT TIYGREYTIV GVETADHLRK VARQVDEKMH EIGSQNHALD SGRLAVLTAV        60
     NATHDYLKLE QKYLELEQEL ARIKGRD                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page