(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1193

AL596167.LIN1193     Location/Qualifiers
FT   CDS             240610..241152
FT                   /transl_table=11
FT                   /gene="lin1193"
FT                   /note="similar to B. subtilis YshB protein"
FT                   /db_xref="GOA:Q92CH8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH8"
FT                   /protein_id="CAC96424.1"
FT                   /translation="MILNAIILILLVCGFFAGFRTGLIKQLILLLGYILAFFISYTYYE
FT                   DLAPHLTFIPYPGSDTSDGLSIILQELRTETAYYNVLGFAIIFIVAIIVVHMLASLVGG
FT                   LTKIPVLRQINGLLAAVFGVIKSYLIIFIVLFVMAIYPANWSENLIDSSTVAQWMLENT
FT                   PILSEQFYDWMTDILPK"
     MILNAIILIL LVCGFFAGFR TGLIKQLILL LGYILAFFIS YTYYEDLAPH LTFIPYPGSD        60
     TSDGLSIILQ ELRTETAYYN VLGFAIIFIV AIIVVHMLAS LVGGLTKIPV LRQINGLLAA       120
     VFGVIKSYLI IFIVLFVMAI YPANWSENLI DSSTVAQWML ENTPILSEQF YDWMTDILPK       180
//

If you have problems or comments...

PBIL Back to PBIL home page