(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1194

AL596167.LIN1194     Location/Qualifiers
FT   CDS             241245..242957
FT                   /transl_table=11
FT                   /gene="lin1194"
FT                   /note="similar to DNA polymerase beta, to B. subtilis YshC
FT                   protein"
FT                   /db_xref="GOA:Q92CH7"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH7"
FT                   /protein_id="CAC96425.1"
FT                   /translation="MATNKKEIIRLLEEIATYMELKGENSFKISAFRKAAQAIELDSRS
FT                   LAEIEDFTKISGIGKTTGEIIQRYLDSGECPELVELKKEVPAGLVPLLDVPGLGGKKLS
FT                   RLYHELGVVDKDTLLKEARNGHIEALKGFGKKSAEKMAEAVREMGERPDRYPLNDVLPI
FT                   IQKVEDYLASIDTIATFARAGSLRRLRETVKDLDYVIATEKPEDVQKALLEFPLITDVI
FT                   GAGETKVSAVLEDNITISVDFRLVEKKAFATTLHHFTGSKDHNIKMRQLAKQSNEKISE
FT                   YGVEQEDGSMRHFESEETFFKHFHIPFLPPEVRRDGTEIERVTKDTKFLELSDIRGDLH
FT                   MHTTWSDGAYAIPEMIEACIAKGYEYMVITDHGKFLRVANGLDEKRLLEQQAEIKKVAA
FT                   NYPEIDVYSGVEMDILADGSLDFDDDTLKQLDFVIASIHSSFQQSEEEIMKRLKTACEN
FT                   PYVRLIAHPTGRIVVKRKPYHVNMKELIKLAKNTGTALELNANPQRLDLNREHLEMAHA
FT                   AGVPIAINTDAHDTKHLDFMSIGVRAATKAWLDKSAILNTKSAAEFKQFLQNK"
     MATNKKEIIR LLEEIATYME LKGENSFKIS AFRKAAQAIE LDSRSLAEIE DFTKISGIGK        60
     TTGEIIQRYL DSGECPELVE LKKEVPAGLV PLLDVPGLGG KKLSRLYHEL GVVDKDTLLK       120
     EARNGHIEAL KGFGKKSAEK MAEAVREMGE RPDRYPLNDV LPIIQKVEDY LASIDTIATF       180
     ARAGSLRRLR ETVKDLDYVI ATEKPEDVQK ALLEFPLITD VIGAGETKVS AVLEDNITIS       240
     VDFRLVEKKA FATTLHHFTG SKDHNIKMRQ LAKQSNEKIS EYGVEQEDGS MRHFESEETF       300
     FKHFHIPFLP PEVRRDGTEI ERVTKDTKFL ELSDIRGDLH MHTTWSDGAY AIPEMIEACI       360
     AKGYEYMVIT DHGKFLRVAN GLDEKRLLEQ QAEIKKVAAN YPEIDVYSGV EMDILADGSL       420
     DFDDDTLKQL DFVIASIHSS FQQSEEEIMK RLKTACENPY VRLIAHPTGR IVVKRKPYHV       480
     NMKELIKLAK NTGTALELNA NPQRLDLNRE HLEMAHAAGV PIAINTDAHD TKHLDFMSIG       540
     VRAATKAWLD KSAILNTKSA AEFKQFLQNK                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page