(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1195

AL596167.LIN1195     Location/Qualifiers
FT   CDS             242980..245337
FT                   /transl_table=11
FT                   /gene="lin1195"
FT                   /note="similar to MutS protein (MutS2)"
FT                   /db_xref="GOA:Q92CH6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH6"
FT                   /protein_id="CAC96426.1"
FT                   /translation="MEKKVEAILEFDKIKKQLAEFASSSLGEQAIYELAPATDFQVVQK
FT                   AQLETEEGAKIIRLRGSAPITGLTDVFAHLKRLEIGGDLNGLEIYQIGSNLRVSRQMKN
FT                   FMNDLLEIGVEIPLLGALSDELLVLKDVEEDIAISIDESGKILDTASEALSSIRRTLRR
FT                   TEDRVREKLESYLRDRNASKMLSDAVITIRNDRYVIPVKQEYKGHYGGIVHDQSASGQT
FT                   LFIEPQSVVDLNNERKALQAKEKQEIERILAEISASLAGWINEIHHNTFILGRFDFILA
FT                   KARFGKALKAVTPHLSDTGIVHLIAARHPLLDAEKVVANDIYLGEDFSTIVITGPNTGG
FT                   KTITLKTLGLLTLMAQSGLQIPAQEDSTIAVFENVFADIGDEQSIEQSLSTFSSHMTNI
FT                   VSILEKVNHKSLILYDELGAGTDPQEGAALAIAILDASHKKGASVVATTHYPELKAYGY
FT                   NRAHATNASVEFNVETLSPTYKLLIGVPGRSNAFDISRRLGLSESIITEARSLVDTESA
FT                   DLNDMISSLEEKRNLAEREYEEARELARGADALLKDLQKEITNYYQQKDKLLEQANEKA
FT                   AGIVEKAETEAEEIIHELRTMQLNGAAGIKEHELIDAKTRLGKAKPKTINKAIPKAPKQ
FT                   KPHVFQAGDNVRVLSLGQKGTLLNKISDKEWNVQIGIIKMKIKTTDLEYIEPEKPKKQR
FT                   IITSVHSSDSPAKSELDLRGERYEDAIQKVDKYLDEALLAGYPQVAIIHGKGTGALRTG
FT                   VTEYLKNHRMVKSIRFGAAAEGGNGVTIVEFK"
     MEKKVEAILE FDKIKKQLAE FASSSLGEQA IYELAPATDF QVVQKAQLET EEGAKIIRLR        60
     GSAPITGLTD VFAHLKRLEI GGDLNGLEIY QIGSNLRVSR QMKNFMNDLL EIGVEIPLLG       120
     ALSDELLVLK DVEEDIAISI DESGKILDTA SEALSSIRRT LRRTEDRVRE KLESYLRDRN       180
     ASKMLSDAVI TIRNDRYVIP VKQEYKGHYG GIVHDQSASG QTLFIEPQSV VDLNNERKAL       240
     QAKEKQEIER ILAEISASLA GWINEIHHNT FILGRFDFIL AKARFGKALK AVTPHLSDTG       300
     IVHLIAARHP LLDAEKVVAN DIYLGEDFST IVITGPNTGG KTITLKTLGL LTLMAQSGLQ       360
     IPAQEDSTIA VFENVFADIG DEQSIEQSLS TFSSHMTNIV SILEKVNHKS LILYDELGAG       420
     TDPQEGAALA IAILDASHKK GASVVATTHY PELKAYGYNR AHATNASVEF NVETLSPTYK       480
     LLIGVPGRSN AFDISRRLGL SESIITEARS LVDTESADLN DMISSLEEKR NLAEREYEEA       540
     RELARGADAL LKDLQKEITN YYQQKDKLLE QANEKAAGIV EKAETEAEEI IHELRTMQLN       600
     GAAGIKEHEL IDAKTRLGKA KPKTINKAIP KAPKQKPHVF QAGDNVRVLS LGQKGTLLNK       660
     ISDKEWNVQI GIIKMKIKTT DLEYIEPEKP KKQRIITSVH SSDSPAKSEL DLRGERYEDA       720
     IQKVDKYLDE ALLAGYPQVA IIHGKGTGAL RTGVTEYLKN HRMVKSIRFG AAAEGGNGVT       780
     IVEFK                                                                   785
//

If you have problems or comments...

PBIL Back to PBIL home page