(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1198

AL596167.LIN1198     Location/Qualifiers
FT   CDS             247799..249013
FT                   /transl_table=11
FT                   /gene="lin1198"
FT                   /note="similar to aspartokinase II alpha subunit"
FT                   /db_xref="GOA:Q92CH4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH4"
FT                   /protein_id="CAC96429.1"
FT                   /translation="MGLVVLKFGGTSVSTVDKIGKTADQAIYEKKQGNKVIVVVSAMGK
FT                   STDKLVAMAEEISEAPDKREMDMLLSTGEQITIALLAMTLKEKGHDAISYTGWQAGIET
FT                   EAVHSNARIADIDSARIESALEAGQIVIVAGFQGITTDGEITTLGRGGSDTTAVAIASA
FT                   LKAEKCAICTDVVGVFTTDPRYVKKAQKLEQLTYDEMLELANLGAGVLHPRSVEYAKNF
FT                   RIPLEVRASHELEPGTMIEEDLTMENTKVVRGIAFEDQITRVTIHWKQKEAMRVSKVFT
FT                   KLAENNIDVDIIIQGITGLGHGNLSFTIKTSELLATLAVLEESKELLQIEKLESEQELA
FT                   KVSIVGSGMVSNPGVAAKMFEALTENNIPIKMISTSEIKVSTVVPARKMVEAAQVLHDQ
FT                   FELDK"
     MGLVVLKFGG TSVSTVDKIG KTADQAIYEK KQGNKVIVVV SAMGKSTDKL VAMAEEISEA        60
     PDKREMDMLL STGEQITIAL LAMTLKEKGH DAISYTGWQA GIETEAVHSN ARIADIDSAR       120
     IESALEAGQI VIVAGFQGIT TDGEITTLGR GGSDTTAVAI ASALKAEKCA ICTDVVGVFT       180
     TDPRYVKKAQ KLEQLTYDEM LELANLGAGV LHPRSVEYAK NFRIPLEVRA SHELEPGTMI       240
     EEDLTMENTK VVRGIAFEDQ ITRVTIHWKQ KEAMRVSKVF TKLAENNIDV DIIIQGITGL       300
     GHGNLSFTIK TSELLATLAV LEESKELLQI EKLESEQELA KVSIVGSGMV SNPGVAAKMF       360
     EALTENNIPI KMISTSEIKV STVVPARKMV EAAQVLHDQF ELDK                        404
//

If you have problems or comments...

PBIL Back to PBIL home page