(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1199

AL596167.LIN1199     Location/Qualifiers
FT   CDS             complement(249085..249570)
FT                   /transl_table=11
FT                   /gene="lin1199"
FT                   /note="similar to B. subtilis YslB protein"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CH3"
FT                   /protein_id="CAC96430.1"
FT                   /translation="MVYESEVSEMTENEQNNYEEKALVPSFGLDVLRDYLIPEILGDEA
FT                   PHIMYWAGKDLARKFPLESMEEIREFFEEASFGTLSILKEKKDELRLLLEGDMVVSRFR
FT                   TQENPTFKLEAGFIAEQLQTQKKLYTESYDEIDKRKKQVTIIVKWDRKETIDNEERY"
     MVYESEVSEM TENEQNNYEE KALVPSFGLD VLRDYLIPEI LGDEAPHIMY WAGKDLARKF        60
     PLESMEEIRE FFEEASFGTL SILKEKKDEL RLLLEGDMVV SRFRTQENPT FKLEAGFIAE       120
     QLQTQKKLYT ESYDEIDKRK KQVTIIVKWD RKETIDNEER Y                           161
//

If you have problems or comments...

PBIL Back to PBIL home page