(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1202

AL596167.LIN1202     Location/Qualifiers
FT   CDS             251291..251902
FT                   /transl_table=11
FT                   /gene="lin1202"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YsnA protein"
FT                   /db_xref="GOA:Q92CH0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH0"
FT                   /protein_id="CAC96433.1"
FT                   /translation="MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGT
FT                   TFAENAALKAETVASLLNQTVIADDSGLIVDVLNGAPGVYSARYAGVAHDDAKNNEKLL
FT                   KNLEGVEPAKRTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPE
FT                   FGLTMAEIPAEKKNEISHRANAIKQLEKDLAEVVEKVTKK"
     MSKIIIATAN KGKAKEFEKI FAKFNIEVAT LADFPEIGEI EETGTTFAEN AALKAETVAS        60
     LLNQTVIADD SGLIVDVLNG APGVYSARYA GVAHDDAKNN EKLLKNLEGV EPAKRTARFH       120
     CTLAVATPSE KTSFYTGEVE GVIAEQLCGT NGFGYDPLFF LPEFGLTMAE IPAEKKNEIS       180
     HRANAIKQLE KDLAEVVEKV TKK                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page