(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1203

AL596167.LIN1203     Location/Qualifiers
FT   CDS             251940..252464
FT                   /transl_table=11
FT                   /gene="lin1203"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YsnB protein"
FT                   /db_xref="GOA:Q92CG9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CG9"
FT                   /protein_id="CAC96434.1"
FT                   /translation="MKLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAI
FT                   QGFHTVRGNCDFGGGFPNDWVGEVDGYRILTTHGHLYNIKMTLMNLRYRARELNADFAF
FT                   FGHSHELGVDMLDDTIILNPGSISLPRGRIRIKTYALIDSTPEGIKVRFMDRDDNELTD
FT                   LTQVFPLTKHN"
     MKLLVVSDSH SERDCLIHLK EKYENTVDAM IHCGDSELEA DDPAIQGFHT VRGNCDFGGG        60
     FPNDWVGEVD GYRILTTHGH LYNIKMTLMN LRYRARELNA DFAFFGHSHE LGVDMLDDTI       120
     ILNPGSISLP RGRIRIKTYA LIDSTPEGIK VRFMDRDDNE LTDLTQVFPL TKHN             174
//

If you have problems or comments...

PBIL Back to PBIL home page