(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHA

AL596167.PDHA        Location/Qualifiers
FT   CDS             96423..97538
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 alpha
FT                   subunit)"
FT                   /db_xref="GOA:Q92CX7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX7"
FT                   /protein_id="CAC96275.1"
FT                   /translation="MASKTKKAIIDVKKQFEAVHKQFELVQILNEKGEIVNPDLMPDLT
FT                   DDELVELMTRMVWTRVLDQRSISLNRQGRLGFYAPTAGQEASQLASHYALEKHDYILPG
FT                   YRDVPQLIWHGLPLTKAFLFSRGHFVGNQFPEDLNVLSPQIIIGAQIVQAAGVALGLKK
FT                   RKKDAVVITYTGDGGSSQGDFYEGMNFAGAYHAPAIFVVQNNKFAISTPREKQSAAETL
FT                   AQKAVAAGIPGVQVDGMDPLAVYAVTKFARERAVAGEGPTLIETMTYRYGPHTLSGDDP
FT                   TRYRTKELDGEWELKDPIVRFRTFLEGKGLWNEEKENAVIDQAKEEIKVAIKEADATPK
FT                   QTVTDLLKNMYETPTAPIKEQLAIYEAKESK"
     MASKTKKAII DVKKQFEAVH KQFELVQILN EKGEIVNPDL MPDLTDDELV ELMTRMVWTR        60
     VLDQRSISLN RQGRLGFYAP TAGQEASQLA SHYALEKHDY ILPGYRDVPQ LIWHGLPLTK       120
     AFLFSRGHFV GNQFPEDLNV LSPQIIIGAQ IVQAAGVALG LKKRKKDAVV ITYTGDGGSS       180
     QGDFYEGMNF AGAYHAPAIF VVQNNKFAIS TPREKQSAAE TLAQKAVAAG IPGVQVDGMD       240
     PLAVYAVTKF ARERAVAGEG PTLIETMTYR YGPHTLSGDD PTRYRTKELD GEWELKDPIV       300
     RFRTFLEGKG LWNEEKENAV IDQAKEEIKV AIKEADATPK QTVTDLLKNM YETPTAPIKE       360
     QLAIYEAKES K                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page