(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHB

AL596167.PDHB        Location/Qualifiers
FT   CDS             97541..98518
FT                   /transl_table=11
FT                   /gene="PdhB"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 beta
FT                   subunit)"
FT                   /db_xref="GOA:Q92CX6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX6"
FT                   /protein_id="CAC96276.1"
FT                   /translation="MAQKTMIQAITDALAVELEKDENVLVFGEDVGKNGGVFRATEGLQ
FT                   EKFGEDRVFDTPLAESGIGGLAIGLALEGFRPVPEIQFFGFVFEVMDSVAGQMARMRYR
FT                   TGGTRTAPITIRAPFGGGVHTPEMHADNLEGLMAQSPGLKVVIPSTPYDAKGLLISAIR
FT                   DNDPVIFLEHMKLYRSFREEVPEGEYTVEIGKAAVRREGTDVSIITYGAMVQESMKAAE
FT                   ALEKDGVSVEVIDLRTISPIDVETIIASVKKTNRAVVVQEAQKQAGIAANIVAEINDHA
FT                   ILSLEAPVMRVAAPDSVFPFSQAETVWLPNHNDIIERVKEVIAF"
     MAQKTMIQAI TDALAVELEK DENVLVFGED VGKNGGVFRA TEGLQEKFGE DRVFDTPLAE        60
     SGIGGLAIGL ALEGFRPVPE IQFFGFVFEV MDSVAGQMAR MRYRTGGTRT APITIRAPFG       120
     GGVHTPEMHA DNLEGLMAQS PGLKVVIPST PYDAKGLLIS AIRDNDPVIF LEHMKLYRSF       180
     REEVPEGEYT VEIGKAAVRR EGTDVSIITY GAMVQESMKA AEALEKDGVS VEVIDLRTIS       240
     PIDVETIIAS VKKTNRAVVV QEAQKQAGIA ANIVAEINDH AILSLEAPVM RVAAPDSVFP       300
     FSQAETVWLP NHNDIIERVK EVIAF                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page