(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHC

AL596167.PDHC        Location/Qualifiers
FT   CDS             98629..100263
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /note="highly similar to pyruvate dehydrogenase
FT                   (dihydrolipoamide acetyltransferase E2 subunit)"
FT                   /db_xref="GOA:Q92CX5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX5"
FT                   /protein_id="CAC96277.1"
FT                   /translation="MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSV
FT                   EEITSPVSGTIKEIKVAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAP
FT                   AQASGKGIFEFKLPDIGEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVD
FT                   GTVKDILVSEGTVATVGQVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPATGG
FT                   NGTPSSKKDPNGLVIAMPSVRKYAREKDVNIAEVAGSGKNNRVVKADIDAFLNGEQPAA
FT                   ATTTAQTEEKAAAPKAEKAAAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHV
FT                   TLMDEIEVTALMAHRKRFKEVAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEE
FT                   LVYKHYFNVGIAADTDHGLYVPVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHG
FT                   SATISNIGSAGGQWFTPVINYPEVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRV
FT                   IDGATAQKAMNNIKRLLNDPELLLMEV"
     MAYSFKLPDI GEGIHEGEIV KWFVQPGDKI EEDESLFEVQ NDKSVEEITS PVSGTIKEIK        60
     VAEGTVATVG QVLVTFDGVE GHEDDAEEES AAPKAESTES TPAPAQASGK GIFEFKLPDI       120
     GEGIHEGEIV KWFIQPGDKV EEDQSIFEVQ NDKSVEEITS PVDGTVKDIL VSEGTVATVG       180
     QVLVTFEGDF EGEASHESTP ESPAEEAELT NNDATSAPAT GGNGTPSSKK DPNGLVIAMP       240
     SVRKYAREKD VNIAEVAGSG KNNRVVKADI DAFLNGEQPA AATTTAQTEE KAAAPKAEKA       300
     AAKQPVASSD AYPETREKLT PTRRAIAKAM VNSKHTAPHV TLMDEIEVTA LMAHRKRFKE       360
     VAAEKGIKLT FLPYMVKALV ATLRDFPVLN TTLDDATEEL VYKHYFNVGI AADTDHGLYV       420
     PVIKNADKKS VFQISDEINE LAGKARDGKL TADEMRHGSA TISNIGSAGG QWFTPVINYP       480
     EVAILGVGRI AQKPIVKDGE IVAAPVLALS LSFDHRVIDG ATAQKAMNNI KRLLNDPELL       540
     LMEV                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page