(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHD

AL596167.PDHD        Location/Qualifiers
FT   CDS             100268..101671
FT                   /transl_table=11
FT                   /gene="PdhD"
FT                   /note="highly similar to dihydrolipoamide dehydrogenase, E3
FT                   subunit of pyruvate dehydrogenase complex "
FT                   /db_xref="GOA:Q92CX4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX4"
FT                   /protein_id="CAC96278.1"
FT                   /translation="MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGG
FT                   VCLNVGCIPSKALITIGHRFKEAGHSDNMGITADNVNLDFTKAQEWKGGVVNKLTSGVK
FT                   GLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYGKRV
FT                   LSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSL
FT                   VKRNLKSKNVEMVTKALAKSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEI
FT                   GLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVPLAHKASYEAKIAAEAIAGEK
FT                   AENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVR
FT                   LVTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAE
FT                   LALGRPIHM"
     MVVGDFPEER DTIVIGAGPG GYVAAIRAAQ LGQKVTIIEK EYYGGVCLNV GCIPSKALIT        60
     IGHRFKEAGH SDNMGITADN VNLDFTKAQE WKGGVVNKLT SGVKGLLKKN KVEMLEGEAF       120
     FVDDHSLRVI HPDSAQTYTF NNVIIATGSR PIEIPGFKYG KRVLSSTGAL ALTEVPKKLV       180
     VIGGGYIGTE LGGAFANLGT ELTILEGGPE ILPTYEKDMV SLVKRNLKSK NVEMVTKALA       240
     KSAEETENGV KVTYEANGET KTIEADYVLV TVGRRPNTDE IGLEQAGVKV TERGLVEVDK       300
     QGRSNVSNIF AIGDIVPGVP LAHKASYEAK IAAEAIAGEK AENDYTALPA VVFSDPELAT       360
     VGLTEKEAKE KGFDVKAAKF PFGGNGRALS LDAPEGFVRL VTRKEDGLVI GAQVAGMNAS       420
     DIISEIGLAI ESGITAEDIA LTIHAHPSLG ELTMEAAELA LGRPIHM                     467
//

If you have problems or comments...

PBIL Back to PBIL home page