(data stored in ACNUC9435 zone)

EMBL: AL596167.PHES

AL596167.PHES        Location/Qualifiers
FT   CDS             226944..227996
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /product="phenylalany-tRNA synthetase alpha subunit "
FT                   /db_xref="GOA:Q92CI7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI7"
FT                   /protein_id="CAC96415.1"
FT                   /translation="MLEQLQTLKSEAETQINEAADLKTLNDLRVKYLGKKGPMTEIMKQ
FT                   MGKLSAEERPKMGSLANEVRTALTEAISSKQEILETAAINEKLKSETIDVTLPGTAPSI
FT                   GTKHLLTQVIEEMEDMFIGMGYEIAEGPEVELDYYNFEALNLPKDHPARDMQDSFYITE
FT                   NTLLRTQTSPVQARTMEKHDFSKGPIKVICPGKVYRRDNDDATHSHQFTQIEGLVVGEN
FT                   ITFADLKGTLTVLAKTMFGEEREIRLRPSFFPFTEPSVEMDISCFKCGGKGCRVCKGTG
FT                   WIEILGSGMVHPNVLEMSGIDSTRYSGFAFGLGPERVAMLKYAVDDIRHLYTNDLRFTK
FT                   QFQSTETGEI"
     MLEQLQTLKS EAETQINEAA DLKTLNDLRV KYLGKKGPMT EIMKQMGKLS AEERPKMGSL        60
     ANEVRTALTE AISSKQEILE TAAINEKLKS ETIDVTLPGT APSIGTKHLL TQVIEEMEDM       120
     FIGMGYEIAE GPEVELDYYN FEALNLPKDH PARDMQDSFY ITENTLLRTQ TSPVQARTME       180
     KHDFSKGPIK VICPGKVYRR DNDDATHSHQ FTQIEGLVVG ENITFADLKG TLTVLAKTMF       240
     GEEREIRLRP SFFPFTEPSV EMDISCFKCG GKGCRVCKGT GWIEILGSGM VHPNVLEMSG       300
     IDSTRYSGFA FGLGPERVAM LKYAVDDIRH LYTNDLRFTK QFQSTETGEI                  350
//

If you have problems or comments...

PBIL Back to PBIL home page