(data stored in ACNUC9435 zone)

EMBL: AL596167.PHET

AL596167.PHET        Location/Qualifiers
FT   CDS             227996..230404
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="GOA:Q92CI6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI6"
FT                   /protein_id="CAC96416.1"
FT                   /translation="MLVSYNWVKEFFQDFPLTAEELGEAITRTGIEIEGVEELSASLKN
FT                   VVVGEVLSCERHPDAEKLNKCLVQTDEEEPVQIICGAPNVAAGQKVIVAKVGARLPGGL
FT                   KIKRAKLRGEVSEGMICSLAELGFESKVVPKAYADGIYVLPEHVETGVSAITLLGLDDA
FT                   ILDMAITPNRADALSMNGVAHEVGAIIHQKPAQPTEPDVSEKGKADDFISVEVENPTET
FT                   PYYAIKMVENIEIKESPLWLQTKLMKAGIRPHNNVVDVTNYINLLYGQPLHSFDYDKIG
FT                   SKKIVVRSAKDQEEITTLDGEKRILQTGHTVITNGTEPIAIAGVMGGEFSEVTETTTTV
FT                   ALEGAIFSSSSVGKASRELYLRTEASIRYDKGSDAWKVEKALAHGGALIAELSGGTLVG
FT                   GVVEVDNREKAVNKIETSLTRINRILGTEISLSEIETIFDRLGFVLEVKEDTLIIEVPT
FT                   RRWDITIEADILEEVARIYGYDEIPVTLPATSTTGGLSDSQKARRVMRAYLEGAGLNQA
FT                   LTYSLTSKKDATRLALSDEKTVALSMPMSEEHSHLRTSIVPQLIRSASYNIARKNMDVA
FT                   LYEMGTVFYATEGDNLPIEQEHLAGLITGNWHTADWQKTPKPVDFFVLKGIVEGLVNKL
FT                   GIEAELHWKQIEKEELHPGRTASIQLEGKEIGYLGALHPAVEASYDLKETYVFEINVKA
FT                   LLDATKEKVVYHPIPRYPEMTRDLALLVDKDTDHATISQVIKEHGGNLLVDIELFDIFE
FT                   GESLGENKKSLAYTLTFLDSERTLVEEDVQKATNKVVEALQAKLHAIIR"
     MLVSYNWVKE FFQDFPLTAE ELGEAITRTG IEIEGVEELS ASLKNVVVGE VLSCERHPDA        60
     EKLNKCLVQT DEEEPVQIIC GAPNVAAGQK VIVAKVGARL PGGLKIKRAK LRGEVSEGMI       120
     CSLAELGFES KVVPKAYADG IYVLPEHVET GVSAITLLGL DDAILDMAIT PNRADALSMN       180
     GVAHEVGAII HQKPAQPTEP DVSEKGKADD FISVEVENPT ETPYYAIKMV ENIEIKESPL       240
     WLQTKLMKAG IRPHNNVVDV TNYINLLYGQ PLHSFDYDKI GSKKIVVRSA KDQEEITTLD       300
     GEKRILQTGH TVITNGTEPI AIAGVMGGEF SEVTETTTTV ALEGAIFSSS SVGKASRELY       360
     LRTEASIRYD KGSDAWKVEK ALAHGGALIA ELSGGTLVGG VVEVDNREKA VNKIETSLTR       420
     INRILGTEIS LSEIETIFDR LGFVLEVKED TLIIEVPTRR WDITIEADIL EEVARIYGYD       480
     EIPVTLPATS TTGGLSDSQK ARRVMRAYLE GAGLNQALTY SLTSKKDATR LALSDEKTVA       540
     LSMPMSEEHS HLRTSIVPQL IRSASYNIAR KNMDVALYEM GTVFYATEGD NLPIEQEHLA       600
     GLITGNWHTA DWQKTPKPVD FFVLKGIVEG LVNKLGIEAE LHWKQIEKEE LHPGRTASIQ       660
     LEGKEIGYLG ALHPAVEASY DLKETYVFEI NVKALLDATK EKVVYHPIPR YPEMTRDLAL       720
     LVDKDTDHAT ISQVIKEHGG NLLVDIELFD IFEGESLGEN KKSLAYTLTF LDSERTLVEE       780
     DVQKATNKVV EALQAKLHAI IR                                                802
//

If you have problems or comments...

PBIL Back to PBIL home page