(data stored in ACNUC9435 zone)

EMBL: AL596167.PTSH

AL596167.PTSH        Location/Qualifiers
FT   CDS             59521..59787
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /product="PTS phosphocarrier protein Hpr (histidine
FT                   containing protein)"
FT                   /db_xref="GOA:P0A439"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A439"
FT                   /protein_id="CAC96232.1"
FT                   /translation="MEQASFVVIDETGIHARPATLLVQAASKYSSDVQIEYTGKKVNLK
FT                   SIMGVMSLGIGKGADITIYTEGSDEKEAIEGLTEVLKKEGLAE"
     MEQASFVVID ETGIHARPAT LLVQAASKYS SDVQIEYTGK KVNLKSIMGV MSLGIGKGAD        60
     ITIYTEGSDE KEAIEGLTEV LKKEGLAE                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page