(data stored in ACNUC9435 zone)

EMBL: AL596167.TAGD

AL596167.TAGD        Location/Qualifiers
FT   CDS             136985..137368
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /note="highly similar to glycerol-3-phosphate
FT                   cytidylyltransferase (gct), CDP-glycerol pyrophosphorylase
FT                   (teichoic acid biosynthesis protein D)"
FT                   /db_xref="GOA:Q92CU5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU5"
FT                   /protein_id="CAC96307.1"
FT                   /translation="MKKVITYGTFDLIHWGHIRLLERAKALGDYLIVAISTDEFNRIKH
FT                   KEAYHNFEHRKLILEAIRYVDEVIPESNWEQKLEDVKNRDIDIFVMGDDWEGEFDFLKP
FT                   YCEVVYLPRTDGISTSKIKDDLK"
     MKKVITYGTF DLIHWGHIRL LERAKALGDY LIVAISTDEF NRIKHKEAYH NFEHRKLILE        60
     AIRYVDEVIP ESNWEQKLED VKNRDIDIFV MGDDWEGEFD FLKPYCEVVY LPRTDGISTS       120
     KIKDDLK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page