(data stored in ACNUC9435 zone)

EMBL: AL596167.UVRC

AL596167.UVRC        Location/Qualifiers
FT   CDS             245805..247616
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /note="highly similar to excinuclease ABC subunit C"
FT                   /db_xref="GOA:Q92CH5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH5"
FT                   /protein_id="CAC96428.1"
FT                   /translation="MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSY
FT                   FSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIK
FT                   ITNERHPRLIITRQVKKDKGKYFGPYPNVYAANEVKRILDRLYPLRKCSTLPNKVCLYY
FT                   HLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEF
FT                   RDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFY
FT                   NDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKIIVPQRGNKKELVK
FT                   LAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSA
FT                   MVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGK
FT                   GQIDSAKDVLTNELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQ
FT                   DEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEA
FT                   GVPLNVAEEVHKHITAFNEKAKNTEQK"
     MSSEHIQNKL ALLPDQPGCY LMKDRQGTII YVGKAKVLKN RVRSYFSGTH DSKTQRLVQE        60
     IVDFEYIVTS SNVEALLLEI NLIKKHDPRF NIRLKDDKTY PFIKITNERH PRLIITRQVK       120
     KDKGKYFGPY PNVYAANEVK RILDRLYPLR KCSTLPNKVC LYYHLGQCLA PCVFDVEASK       180
     YKEMQDEIVA FLNGGYKTVK NDLMKKMQEA AENMEFEKAG EFRDQINAIE TTMEKQKMTM       240
     NDFVDRDVFG YAIDKGWMCV QVFFIRQGKL IERDVSQFPF YNDADEDFLT FIGQFYQKAN       300
     HIPPKEIYLP DDVDSEAVQA VVPDTKIIVP QRGNKKELVK LAYKNAKIAL NEKFMLLERN       360
     EERTVGAVER LGEAMGIPTP SRVEAFDNSN IHGTDPVSAM VTFLDGKPSK NDYRKYKIKT       420
     VEGPDDYATM REVIRRRYWR VLKEGLPMPD LILIDGGKGQ IDSAKDVLTN ELGLDIPVAG       480
     LAKDDKHRTS QLLFGDPLEI VPLERNSQEF YLLQRMQDEV HRFAITFHRQ LRSKTGFQSI       540
     LDGIPGVGPG RKKKLLKHFG SMKKLKEASV EEIKEAGVPL NVAEEVHKHI TAFNEKAKNT       600
     EQK                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page