(data stored in ACNUC9543 zone)

EMBL: AL844507.PE1

AL844507.PE1         Location/Qualifiers
FT   CDS             join(21361..26364,27295..28653)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800100"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800100"
FT                   /db_xref="GOA:Q8IAK1"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK1"
FT                   /protein_id="CAD51363.1"
FT                   /translation="MAAAGGGGKDKYKNAQDAKHLLDIIGEDIYKIANDAALKRSGSEL
FT                   KGLLSLAKFEKNPPDKQTPEDPCDLDYKYHTNVTSNVIEPCNKRSGKRFSEVSGAECAN
FT                   NRIKGNKGSNGDACAPFRRLHVCDRNLEQIDPAKITATHNLLVDVCQAAKFEGQSITQD
FT                   YPKYLATYNDSPSQICTMLARSFADIGDIVRGKDLFRGYDDEEKNRRKKLEQKLKVIFG
FT                   HIYEELKKHKKLKEEAEERYKKDGDNYYKLREDWWALNRQEIWKAITCGHPGGTYFRQT
FT                   ACGGGTTPTPNKCRCATNDVPTYFDYVPQYLRWFEEWAEDFCRKRKYKLENAIEKCRGK
FT                   TKGEKYCDLNGFDCTQTASGEKKFVKGHNCHNCSVTCIPFGPWIDNQKKEFLKQRNKYQ
FT                   NEISSNSRKKRSTSNNNYKGYDEEFYKILKEDYGDVEQFLEKLSREGICQSQPTVGNQK
FT                   ADAANFTKDNPAKTFSHTEYCQACPWCGVVCKSGNCTKNPEGSCTEQIRKKVYDDSNTT
FT                   TIPVLTPEKGKTSILQKYKTFCEKPEKHNQINNWECHYEKTDISNNCILGKWEKFQKGQ
FT                   EVMVYHPFFWKWVTEMLDDSIKWRKELDNCLKNENKQCISKCNGKCDCYKRWVEQKKEK
FT                   EWTQIKDHFGKQEDMKEQIRGADPGIILEGVLDIEDLFENIKDTYGDVKEIDHIKKLLE
FT                   EETTVDADNQNKTTIDKLLDHEDKDAKGCLQKQNECKEQERDGGARSDSQEPTPRSEVK
FT                   PDSEDLDDDDEDDPDEEKSEEVENPEDQGEEEGTKQGSGEKKVDGTEAVQETVAEVTPE
FT                   KKDEVNPCEIVKTLFEKPENLSDACGLKYGPGGKERYSQWKCIPTKPNSDNKGEVGSAG
FT                   RVARSAPSGEKGSICVPPRRRRLYVKDLETLGDSEVTQVQLRDAFIKCAAVETFFLWDR
FT                   YKKEKEKKKPQEGVLQLLGTVGTPPTDDEEDPPEKMLQKGEIPEEFKRQMFYTLADYKD
FT                   ILFGDQEVIKTLKDSGDENIKDISEKIKKTLNGDNNQESGSSPSLSGKKTTPKDWWETY
FT                   GKDIWEGMVCALTYKNSGDKKIEQVKTADDGEDLFQKLKTQYEYNTVTLKDENSGTEGA
FT                   KPFTPKTVSSSSGEKNPPKLSDFVLRPPYFRYLEEWGETFCRQRARMLDKIKKDCNVEE
FT                   NDNRPGGGITKQYSGDGESCKDYLPDDPTTLPDLVSSCPKSCSSYRKWINKKKDEFVEQ
FT                   QNAYTEQQNKCQSKSDKAKSDNGFYTRLQNLPDAAAFLKTLGSCSKNDIPEYKIDFDVN
FT                   GETFRYEKYCGTCPEFKINCTKVKCTSGDMQNGCKDNKINAANFKTMAQSTEINMLVSD
FT                   NSGNGSQNDLKDCKTSGIFKGFREDVWTCGKVCGYNVCKPKNVNGQNGDGNQILLFNAL
FT                   LKRWVEYFLEDYKKIKHKISHCKNSSEGHTCIKNCVEQWISTKRTEWETIRGRFNDQYK
FT                   SNDSDVYPVRSFLETWIPKIPVANANNDGKKLIKLSKFDNFCSCSASAHSPNGKDDAID
FT                   CMINRLQDKIDKCKEKHPQPSAENQTTCDESTLVEDVDDYEEQNPENKVGKPAICGNVD
FT                   TTEPVKEEDEEECKAAESPAEPEQAAEEESVPAAETKDTENQPPQAPDVGPPPLAPAPA
FT                   DQPLDPTILQTTIPFGIAIALTSIVFLFLKKKTKSTIDLLRVINIPKSDYDIPTKLSPN
FT                   RYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYVPRAPKY
FT                   KTLIEVVLEPSGNNTTASGNNTTASDTQNDIQNDIPSDIPKTPSDTPPPITDDEWNQLK
FT                   DEFISQYLQSEQPKDVPNDYSSGDIPLNTQPNTLYFDKPQEKPFITSIHDRNLYSGEEY
FT                   NYDMFNSGKNGPYSDKNDLYSGNHDSLSGNRDPTSANHDSYSGNHHPYSGIDLINDSIS
FT                   GNQHIDIYDELLKRKENELFGTNNPKRTSTYSVAKLTNSDPIHNQLELFHTWLDRHRDM
FT                   CEKWENHHERLAKLKEEWENETHSGNTHPSDSNKTLNTDVSIQIDMDHEKRMKEFTNMD
FT                   TILEDLDKPFNEPYYYDMYDDDIYYDVNDHDTSTVDSNAMDVPSKVQIEMDVNTKLVKE
FT                   KYPIGDVWDI"
     MAAAGGGGKD KYKNAQDAKH LLDIIGEDIY KIANDAALKR SGSELKGLLS LAKFEKNPPD        60
     KQTPEDPCDL DYKYHTNVTS NVIEPCNKRS GKRFSEVSGA ECANNRIKGN KGSNGDACAP       120
     FRRLHVCDRN LEQIDPAKIT ATHNLLVDVC QAAKFEGQSI TQDYPKYLAT YNDSPSQICT       180
     MLARSFADIG DIVRGKDLFR GYDDEEKNRR KKLEQKLKVI FGHIYEELKK HKKLKEEAEE       240
     RYKKDGDNYY KLREDWWALN RQEIWKAITC GHPGGTYFRQ TACGGGTTPT PNKCRCATND       300
     VPTYFDYVPQ YLRWFEEWAE DFCRKRKYKL ENAIEKCRGK TKGEKYCDLN GFDCTQTASG       360
     EKKFVKGHNC HNCSVTCIPF GPWIDNQKKE FLKQRNKYQN EISSNSRKKR STSNNNYKGY       420
     DEEFYKILKE DYGDVEQFLE KLSREGICQS QPTVGNQKAD AANFTKDNPA KTFSHTEYCQ       480
     ACPWCGVVCK SGNCTKNPEG SCTEQIRKKV YDDSNTTTIP VLTPEKGKTS ILQKYKTFCE       540
     KPEKHNQINN WECHYEKTDI SNNCILGKWE KFQKGQEVMV YHPFFWKWVT EMLDDSIKWR       600
     KELDNCLKNE NKQCISKCNG KCDCYKRWVE QKKEKEWTQI KDHFGKQEDM KEQIRGADPG       660
     IILEGVLDIE DLFENIKDTY GDVKEIDHIK KLLEEETTVD ADNQNKTTID KLLDHEDKDA       720
     KGCLQKQNEC KEQERDGGAR SDSQEPTPRS EVKPDSEDLD DDDEDDPDEE KSEEVENPED       780
     QGEEEGTKQG SGEKKVDGTE AVQETVAEVT PEKKDEVNPC EIVKTLFEKP ENLSDACGLK       840
     YGPGGKERYS QWKCIPTKPN SDNKGEVGSA GRVARSAPSG EKGSICVPPR RRRLYVKDLE       900
     TLGDSEVTQV QLRDAFIKCA AVETFFLWDR YKKEKEKKKP QEGVLQLLGT VGTPPTDDEE       960
     DPPEKMLQKG EIPEEFKRQM FYTLADYKDI LFGDQEVIKT LKDSGDENIK DISEKIKKTL      1020
     NGDNNQESGS SPSLSGKKTT PKDWWETYGK DIWEGMVCAL TYKNSGDKKI EQVKTADDGE      1080
     DLFQKLKTQY EYNTVTLKDE NSGTEGAKPF TPKTVSSSSG EKNPPKLSDF VLRPPYFRYL      1140
     EEWGETFCRQ RARMLDKIKK DCNVEENDNR PGGGITKQYS GDGESCKDYL PDDPTTLPDL      1200
     VSSCPKSCSS YRKWINKKKD EFVEQQNAYT EQQNKCQSKS DKAKSDNGFY TRLQNLPDAA      1260
     AFLKTLGSCS KNDIPEYKID FDVNGETFRY EKYCGTCPEF KINCTKVKCT SGDMQNGCKD      1320
     NKINAANFKT MAQSTEINML VSDNSGNGSQ NDLKDCKTSG IFKGFREDVW TCGKVCGYNV      1380
     CKPKNVNGQN GDGNQILLFN ALLKRWVEYF LEDYKKIKHK ISHCKNSSEG HTCIKNCVEQ      1440
     WISTKRTEWE TIRGRFNDQY KSNDSDVYPV RSFLETWIPK IPVANANNDG KKLIKLSKFD      1500
     NFCSCSASAH SPNGKDDAID CMINRLQDKI DKCKEKHPQP SAENQTTCDE STLVEDVDDY      1560
     EEQNPENKVG KPAICGNVDT TEPVKEEDEE ECKAAESPAE PEQAAEEESV PAAETKDTEN      1620
     QPPQAPDVGP PPLAPAPADQ PLDPTILQTT IPFGIAIALT SIVFLFLKKK TKSTIDLLRV      1680
     INIPKSDYDI PTKLSPNRYI PYTSGKYRGK RYIYLEGDSG TDSGYTDHYS DITSSSESEY      1740
     EELDINDIYV PRAPKYKTLI EVVLEPSGNN TTASGNNTTA SDTQNDIQND IPSDIPKTPS      1800
     DTPPPITDDE WNQLKDEFIS QYLQSEQPKD VPNDYSSGDI PLNTQPNTLY FDKPQEKPFI      1860
     TSIHDRNLYS GEEYNYDMFN SGKNGPYSDK NDLYSGNHDS LSGNRDPTSA NHDSYSGNHH      1920
     PYSGIDLIND SISGNQHIDI YDELLKRKEN ELFGTNNPKR TSTYSVAKLT NSDPIHNQLE      1980
     LFHTWLDRHR DMCEKWENHH ERLAKLKEEW ENETHSGNTH PSDSNKTLNT DVSIQIDMDH      2040
     EKRMKEFTNM DTILEDLDKP FNEPYYYDMY DDDIYYDVND HDTSTVDSNA MDVPSKVQIE      2100
     MDVNTKLVKE KYPIGDVWDI                                                  2120
//

If you have problems or comments...

PBIL Back to PBIL home page