(data stored in ACNUC9543 zone)

EMBL: AL844507.PE100

AL844507.PE100       Location/Qualifiers
FT   CDS             complement(join(534469..534510,534685..534786,
FT                   534913..535063,535169..535301,535496..535603,
FT                   535773..535836,535992..536139,536266..536392,
FT                   536583..536619))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810500"
FT                   /product="protein phosphatase PPM7, putative"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.108:mRNA"
FT                   /db_xref="GOA:Q8IAU0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAU0"
FT                   /protein_id="CAD51270.1"
FT                   /translation="MPVINGAHVISMKNYTLVSDAYGEKGVKKVYEDEYLICENLKSFN
FT                   KNLHPNFNFACFCLFDGHNGKNTAMFLKRNLAQELSNSFLEMQNTYDSSLPIPDHFIKI
FT                   SVNNTCKRIDERIAQEYPNSRDGATCVIVLIKDEYAYIINIGDSCAYLCRYLNNSNQAI
FT                   ELVDIHKPWVITEKERIIKHGGTIENGRVNDIIDVTRSFGDLSLKKYGLLCTGTFKKFK
FT                   INSDDNFIILGTDGFFGSVDINYVINEITNLSKKEERLVNVEKKKTVFDAKSICNIMVE
FT                   HAIVDKKSQDNVTVVLIKFLHK"
     MPVINGAHVI SMKNYTLVSD AYGEKGVKKV YEDEYLICEN LKSFNKNLHP NFNFACFCLF        60
     DGHNGKNTAM FLKRNLAQEL SNSFLEMQNT YDSSLPIPDH FIKISVNNTC KRIDERIAQE       120
     YPNSRDGATC VIVLIKDEYA YIINIGDSCA YLCRYLNNSN QAIELVDIHK PWVITEKERI       180
     IKHGGTIENG RVNDIIDVTR SFGDLSLKKY GLLCTGTFKK FKINSDDNFI ILGTDGFFGS       240
     VDINYVINEI TNLSKKEERL VNVEKKKTVF DAKSICNIMV EHAIVDKKSQ DNVTVVLIKF       300
     LHK                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page