(data stored in ACNUC9543 zone)

EMBL: AL844507.PE102

AL844507.PE102       Location/Qualifiers
FT   CDS             complement(join(546163..546217,546312..546432,
FT                   546577..546608,546827..546878,546978..547063,
FT                   547286..547365))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810700"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810700"
FT                   /db_xref="GOA:A0A143ZWS9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZWS9"
FT                   /protein_id="CZT62752.1"
FT                   /translation="MDIVYDWYNSLCCYKTIHKINNYVKVNREILNSQEKEIVYENKYV
FT                   PHTIAVLLALGIQTSFHNMKRLKVFRFRPYLPISFGIITSCSFLYVHNLYMSRKTISKL
FT                   IHLYLMSSNERGVSNKIDQIYKTEEPSDYLYLTRNIS"
     MDIVYDWYNS LCCYKTIHKI NNYVKVNREI LNSQEKEIVY ENKYVPHTIA VLLALGIQTS        60
     FHNMKRLKVF RFRPYLPISF GIITSCSFLY VHNLYMSRKT ISKLIHLYLM SSNERGVSNK       120
     IDQIYKTEEP SDYLYLTRNI S                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page