(data stored in ACNUC9543 zone)

EMBL: AL844507.PE105

AL844507.PE105       Location/Qualifiers
FT   CDS             complement(join(551867..551899,552096..552428))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810900.2"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810900.2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146M1X1"
FT                   /protein_id="CZT62753.1"
FT                   /translation="MSETSACPLNDFFDIDEENNLDEIKKEEKDVFSGNFLSYIYNQFE
FT                   FCCINFFDELKKKDKRKNITLKKNYSDGYSKNDNGQCYYNVFDKILKKDVDTIKEVSLH
FT                   SIYFNPHTGVNAHTNLT"
     MSETSACPLN DFFDIDEENN LDEIKKEEKD VFSGNFLSYI YNQFEFCCIN FFDELKKKDK        60
     RKNITLKKNY SDGYSKNDNG QCYYNVFDKI LKKDVDTIKE VSLHSIYFNP HTGVNAHTNL       120
     T                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page