(data stored in ACNUC9543 zone)

EMBL: AL844507.PE107

AL844507.PE107       Location/Qualifiers
FT   CDS             complement(557884..559506)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811100"
FT                   /product="mitochondrial carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0093:mRNA"
FT                   /db_xref="GOA:Q8IAU6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAU6"
FT                   /protein_id="CAD51264.1"
FT                   /translation="MDIKNEGYNIVNNLMNYLKIGQKNDENKCPNYNIEENGDAKIVKT
FT                   RTLNFIISSAVVLCVLHPLDTIRTRKQIYRVYKNSYPYYYNNKYSLLYILKKEKFESIY
FT                   RGLLASLITTGVSQGTFRFIYDTLNYYIIQNFNNNNNINDNNKITNEINNIGNEKYIIY
FT                   NNINQNNNNNNNNKNENNINMNYYILTSSISSIISVLFLHPIWLIKTKIECTINLNYKF
FT                   INYKSRILSKHYKIFSPRNKIFNYKMIYNIISLFIINPKNKIHGNYKKVRYINNNLMKT
FT                   YKNNFIYNKHIKSVYKYNHLSYIKTNHMCSNKTLQKKMIHNYTLYKYYALSNFERKHLT
FT                   KKCLSTFRKKFRNKHILYSKRPLSGNEILHIFKREENKNNVSAVYKYKNYFHFVYSIYK
FT                   KEKLFSFYKGFLASLLLTPHVALQFYTYEYLTHFFSSQYINNILQNKNIHFSSDVLNKF
FT                   LPFLYGALSKYIAIIFTYPLYTIKMRQQVQMKNYGFYKVLLNIFKCEGIRSYYTGINMH
FT                   LLRNCLQNGILFFIFEYLNNAKI"
     MDIKNEGYNI VNNLMNYLKI GQKNDENKCP NYNIEENGDA KIVKTRTLNF IISSAVVLCV        60
     LHPLDTIRTR KQIYRVYKNS YPYYYNNKYS LLYILKKEKF ESIYRGLLAS LITTGVSQGT       120
     FRFIYDTLNY YIIQNFNNNN NINDNNKITN EINNIGNEKY IIYNNINQNN NNNNNNKNEN       180
     NINMNYYILT SSISSIISVL FLHPIWLIKT KIECTINLNY KFINYKSRIL SKHYKIFSPR       240
     NKIFNYKMIY NIISLFIINP KNKIHGNYKK VRYINNNLMK TYKNNFIYNK HIKSVYKYNH       300
     LSYIKTNHMC SNKTLQKKMI HNYTLYKYYA LSNFERKHLT KKCLSTFRKK FRNKHILYSK       360
     RPLSGNEILH IFKREENKNN VSAVYKYKNY FHFVYSIYKK EKLFSFYKGF LASLLLTPHV       420
     ALQFYTYEYL THFFSSQYIN NILQNKNIHF SSDVLNKFLP FLYGALSKYI AIIFTYPLYT       480
     IKMRQQVQMK NYGFYKVLLN IFKCEGIRSY YTGINMHLLR NCLQNGILFF IFEYLNNAKI       540
//

If you have problems or comments...

PBIL Back to PBIL home page