(data stored in ACNUC9543 zone)

EMBL: AL844507.PE108

AL844507.PE108       Location/Qualifiers
FT   CDS             join(560744..561017,561149..564276)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811200"
FT                   /product="ER membrane protein complex subunit 1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.105:mRNA"
FT                   /db_xref="GOA:Q8IAU7"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="InterPro:IPR026895"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAU7"
FT                   /protein_id="CAD51263.1"
FT                   /translation="MNIIDKRKNKKKNKKKKKKTKKMYNYKLLFHAFIYGILSFIKICY
FT                   GNYASYSNNTYLIGHVNNIIPIPNKLDNLILLSSYDGVVGLLNYKTGKLELAKYHREYE
FT                   SVKKLYGDDKYAAALIYKNNYGSDLSEDNIVEEEDMYNYINVYDINNFYLLSSFEYNNK
FT                   EIINDFIIKGQNIYILLKDKIDIGNINDNSVISISFKELKLDLIYIKIINVKDDKIINL
FT                   FYVDVNKNSYIGSLNILTKKLNKIKKINQLHLTNNTTTTTNNNNNNNNNNNYNYYNSSI
FT                   YNNNVVIIYNYDYLYWIELLNDENEYYYNYISIKDKMDKSKISKANNINKNFITNDYLE
FT                   NCHVGKYICISKEDNVLIYNYDNKKMNFVEKKNQKNQVIGYYLNKENEKVMIIGEDTNK
FT                   NILIKKINNDKKNILLQELKKSNNIYYNPELLIGIYNKEENVNYFFSIYNDLTLTAYKN
FT                   NNVYFTREESLIYIEQLYFYNFQHLKKPNNTTTGFYTPQFHIAKEIEGYIKDKLNLFSS
FT                   PYVQELKKKKQDNSLLPFFFFHLSKEDKMNLLSICTLKKDKSDSFIINKKKLNNEKDKY
FT                   TKLSNQQHMNDKSNFEFMNSLVKNSFDKYASDLSSKYAGSSIILVSTYNNFIYAIHLYT
FT                   GLILYKIDTNVYLKNDNLFDNKSMYRFPIITNENNWSEIDNAKKLIFYNYNIFNNNNNN
FT                   NNNNKMKGEKNSSSNINNTDNNTNIILNDNSVIDLFKGFSKDTVITILKNNNNPSNKKD
FT                   SHILIFDVLNGDIIYEKKVDSFYIKNYFILKNTFSLITLDESLNTKVIHMLNNSPDLNI
FT                   NDEELYFYQINKTDNFIQGYRLIISDRKKRENIDLIKTYSINLNNENVELFSKSITKKD
FT                   IFFPIKINKDASICYKYINDNIVSYITSSKNKTNKIYTLYIIDGISGKLLFSRILDKYV
FT                   NPPFHLIINENKIILNYYHKNIHKNVFHIIEILLDKPDPGFFNLITSKKQKVVNLFDEE
FT                   NIVINETNYIIDHNVKSFNFTETKRGITNKHLLLLLDTNKIAYLPFSNDKNTNIYKNLN
FT                   TFITHTDILYNSRGFISNESLLESTTLIFSWGNNLYFTSYQPNGSFDTIEKFSLLLLLF
FT                   LIFLVFIGTYISYNKRINKKLYAKWE"
     MNIIDKRKNK KKNKKKKKKT KKMYNYKLLF HAFIYGILSF IKICYGNYAS YSNNTYLIGH        60
     VNNIIPIPNK LDNLILLSSY DGVVGLLNYK TGKLELAKYH REYESVKKLY GDDKYAAALI       120
     YKNNYGSDLS EDNIVEEEDM YNYINVYDIN NFYLLSSFEY NNKEIINDFI IKGQNIYILL       180
     KDKIDIGNIN DNSVISISFK ELKLDLIYIK IINVKDDKII NLFYVDVNKN SYIGSLNILT       240
     KKLNKIKKIN QLHLTNNTTT TTNNNNNNNN NNNYNYYNSS IYNNNVVIIY NYDYLYWIEL       300
     LNDENEYYYN YISIKDKMDK SKISKANNIN KNFITNDYLE NCHVGKYICI SKEDNVLIYN       360
     YDNKKMNFVE KKNQKNQVIG YYLNKENEKV MIIGEDTNKN ILIKKINNDK KNILLQELKK       420
     SNNIYYNPEL LIGIYNKEEN VNYFFSIYND LTLTAYKNNN VYFTREESLI YIEQLYFYNF       480
     QHLKKPNNTT TGFYTPQFHI AKEIEGYIKD KLNLFSSPYV QELKKKKQDN SLLPFFFFHL       540
     SKEDKMNLLS ICTLKKDKSD SFIINKKKLN NEKDKYTKLS NQQHMNDKSN FEFMNSLVKN       600
     SFDKYASDLS SKYAGSSIIL VSTYNNFIYA IHLYTGLILY KIDTNVYLKN DNLFDNKSMY       660
     RFPIITNENN WSEIDNAKKL IFYNYNIFNN NNNNNNNNKM KGEKNSSSNI NNTDNNTNII       720
     LNDNSVIDLF KGFSKDTVIT ILKNNNNPSN KKDSHILIFD VLNGDIIYEK KVDSFYIKNY       780
     FILKNTFSLI TLDESLNTKV IHMLNNSPDL NINDEELYFY QINKTDNFIQ GYRLIISDRK       840
     KRENIDLIKT YSINLNNENV ELFSKSITKK DIFFPIKINK DASICYKYIN DNIVSYITSS       900
     KNKTNKIYTL YIIDGISGKL LFSRILDKYV NPPFHLIINE NKIILNYYHK NIHKNVFHII       960
     EILLDKPDPG FFNLITSKKQ KVVNLFDEEN IVINETNYII DHNVKSFNFT ETKRGITNKH      1020
     LLLLLDTNKI AYLPFSNDKN TNIYKNLNTF ITHTDILYNS RGFISNESLL ESTTLIFSWG      1080
     NNLYFTSYQP NGSFDTIEKF SLLLLLFLIF LVFIGTYISY NKRINKKLYA KWE             1133
//

If you have problems or comments...

PBIL Back to PBIL home page