(data stored in ACNUC9543 zone)

EMBL: AL844507.PE11

AL844507.PE11        Location/Qualifiers
FT   CDS             complement(join(84568..88029,88225..88422))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801000"
FT                   /product="Plasmodium exported protein (PHISTc), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0801000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0137:mRNA"
FT                   /db_xref="GOA:Q8IAK9"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK9"
FT                   /protein_id="CAD51354.1"
FT                   /translation="MIFVKSKILYFLKWPSVAIEENFSGSFKCLFKNKRNKYVRNNLSR
FT                   FILSVSLILFFFHFVLCSTIENVEILKNDYNTLTESHNIINRRSRNLGANPESISLGYE
FT                   LSEKDEGNKNDLINSATDVSTELENLKERLFPELELYTNDQNSRNNTPNLRKGSLGFDS
FT                   FKKLELGTLNQFDKDKMINLKDETNMNEFEGFLGRNSMASNVVTSELFDEPVDDSSSTT
FT                   TSTGTKLQNVPSNDNNGELLKDEPIDDYINNNSKVESEDNYYAQQNMQSQSKDNYASEQ
FT                   NVADQSTDNYPTQHDVPVQLRDNYASEQEYFDRGEQLNDVSADNNTSNKLKDEPVDNNT
FT                   SNKLKDEPVDNNTSNKLKDEPVDDNTSNKLKDEPVDNNTINKLKDEPVDDNTSNILKDE
FT                   PVDDHAGKHLKDEPVDDHAGKHMKDEPVDIDRTNIKKGLNEQHVNPWTTTLADLKNINN
FT                   SMKIEKNNKSNEQVKNTSVSKSCDIIKPSKFNKKNLFEQRLQSVEGKNFFEGRSQNLEG
FT                   RSNFDERSQIVEQRRNFDDRDQNIMDRKNFDERNQQVNDRRNFDERNQQVNDRRNFDDR
FT                   DQNVMDRRNFDERNQQVNDRRNFDERNQQVNDRRNFDDRDQNVMDRRNFDERNQQVNDR
FT                   RNFDERNQQVNDRRNFDDRDQNVMDRRNFDERNQQVNDRRNFDERNQQVNDRRNFDERN
FT                   QHVNDRRNFDERNQNVNDRRNFDERNQNVNDRRNFDERNQQVNDRRNFDERYQNVNERR
FT                   NFDERNQQVNDRRNFDERNQHVNERYQNVNDRRNFDERNQQVNDRRNFDERNQHVNERR
FT                   NFDERNQHVNERYQNVNDRRNFDERNQHVNERRNFDQRAPNVEERRYMDPRNPNIPYVR
FT                   FPHHQWGQGMMYGRPYYPWVPFMGDGRGYNFYNPHQHMVYGRPYYWVPPPPALEYTKGF
FT                   NPMEQRREEDRGHMGGRGSRYPEEERYNYNNKRSNSIPEGRNYEENAYERGGGNNKWDF
FT                   RNMYDRLRDEDENDYDQPPSTSSSNRGRGNERYSQSRDRREERNNYNSDYYTRGNERTY
FT                   NNSNVTSSSNRELIPYKKEILPFGVSNSELEDKLTEEELNERIRRLDYTVSVKDMFILW
FT                   NHILAHERKKYTKMQEYLMYYSQYLEKTYLVPTAFRKKYWWRVHYMLTEEVVKRERTDN
FT                   LDFHQFLRKGSCEKREFLYFINSKRKGWADLTETMKNIWMERLTYKMRKYSGA"
     MIFVKSKILY FLKWPSVAIE ENFSGSFKCL FKNKRNKYVR NNLSRFILSV SLILFFFHFV        60
     LCSTIENVEI LKNDYNTLTE SHNIINRRSR NLGANPESIS LGYELSEKDE GNKNDLINSA       120
     TDVSTELENL KERLFPELEL YTNDQNSRNN TPNLRKGSLG FDSFKKLELG TLNQFDKDKM       180
     INLKDETNMN EFEGFLGRNS MASNVVTSEL FDEPVDDSSS TTTSTGTKLQ NVPSNDNNGE       240
     LLKDEPIDDY INNNSKVESE DNYYAQQNMQ SQSKDNYASE QNVADQSTDN YPTQHDVPVQ       300
     LRDNYASEQE YFDRGEQLND VSADNNTSNK LKDEPVDNNT SNKLKDEPVD NNTSNKLKDE       360
     PVDDNTSNKL KDEPVDNNTI NKLKDEPVDD NTSNILKDEP VDDHAGKHLK DEPVDDHAGK       420
     HMKDEPVDID RTNIKKGLNE QHVNPWTTTL ADLKNINNSM KIEKNNKSNE QVKNTSVSKS       480
     CDIIKPSKFN KKNLFEQRLQ SVEGKNFFEG RSQNLEGRSN FDERSQIVEQ RRNFDDRDQN       540
     IMDRKNFDER NQQVNDRRNF DERNQQVNDR RNFDDRDQNV MDRRNFDERN QQVNDRRNFD       600
     ERNQQVNDRR NFDDRDQNVM DRRNFDERNQ QVNDRRNFDE RNQQVNDRRN FDDRDQNVMD       660
     RRNFDERNQQ VNDRRNFDER NQQVNDRRNF DERNQHVNDR RNFDERNQNV NDRRNFDERN       720
     QNVNDRRNFD ERNQQVNDRR NFDERYQNVN ERRNFDERNQ QVNDRRNFDE RNQHVNERYQ       780
     NVNDRRNFDE RNQQVNDRRN FDERNQHVNE RRNFDERNQH VNERYQNVND RRNFDERNQH       840
     VNERRNFDQR APNVEERRYM DPRNPNIPYV RFPHHQWGQG MMYGRPYYPW VPFMGDGRGY       900
     NFYNPHQHMV YGRPYYWVPP PPALEYTKGF NPMEQRREED RGHMGGRGSR YPEEERYNYN       960
     NKRSNSIPEG RNYEENAYER GGGNNKWDFR NMYDRLRDED ENDYDQPPST SSSNRGRGNE      1020
     RYSQSRDRRE ERNNYNSDYY TRGNERTYNN SNVTSSSNRE LIPYKKEILP FGVSNSELED      1080
     KLTEEELNER IRRLDYTVSV KDMFILWNHI LAHERKKYTK MQEYLMYYSQ YLEKTYLVPT      1140
     AFRKKYWWRV HYMLTEEVVK RERTDNLDFH QFLRKGSCEK REFLYFINSK RKGWADLTET      1200
     MKNIWMERLT YKMRKYSGA                                                   1219
//

If you have problems or comments...

PBIL Back to PBIL home page