(data stored in ACNUC9543 zone)

EMBL: AL844507.PE110

AL844507.PE110       Location/Qualifiers
FT   CDS             join(575986..576240,576428..577690,577899..578017,
FT                   578181..578370)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811400"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.103:mRNA"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U0"
FT                   /protein_id="CAX64116.1"
FT                   /translation="MNENDKLKNILDQKEETLIDTKEDDNLIENNIKEYENISKKNFEI
FT                   LKFLNKDELILLIDKLNKEGNLSAIIDQEIKQDTLDILKNFENEQYDTIELEDKDEKAE
FT                   NEEDEEEECYYMNMCKYIPLRLTYEERLYLRLLESTLEVSEYTDKIDILHSGNKNKKII
FT                   KEIKTLCSILSGLVIANNYENGQKLIRDRDFIKNSHFFSFVFEIGRRYKILNPDRMRSS
FT                   YGKLMYFLMDTRKEDIYDLLSFDCVSPIKTVYGLLKERKNGFDLLKDSLIKIATMQIDG
FT                   KGNRNEIQKQIKQKEDAIKYLARKYSNDKNNKKNLFRINIPIFNSQTNTEEDTNNSEEL
FT                   PSLSSEEIERCLYSLCDYNTHIKMFCQPCEIMIQYLKSFYDPNDRNSPYSLSIETGKQG
FT                   SRLTHSHSRQYMYVLQTLYLWREIGEHMFFLWTCAENDMLDLKNPYRLIDTGQGLNRMQ
FT                   SGHTVLGVMRKILHNVQKKVGGWVGSSMIHMGDTNIPNTFMFIDKYTQVPRILNPIVLC
FT                   LQEIDELYESTPAMKNYINTEFNGAHNLKMMITCDFFRHGFDGSGGDNFNEAGSCIDGR
FT                   LTSAWNWCSKIEKKKYFPIFLLTGFVGFDGTF"
     MNENDKLKNI LDQKEETLID TKEDDNLIEN NIKEYENISK KNFEILKFLN KDELILLIDK        60
     LNKEGNLSAI IDQEIKQDTL DILKNFENEQ YDTIELEDKD EKAENEEDEE EECYYMNMCK       120
     YIPLRLTYEE RLYLRLLEST LEVSEYTDKI DILHSGNKNK KIIKEIKTLC SILSGLVIAN       180
     NYENGQKLIR DRDFIKNSHF FSFVFEIGRR YKILNPDRMR SSYGKLMYFL MDTRKEDIYD       240
     LLSFDCVSPI KTVYGLLKER KNGFDLLKDS LIKIATMQID GKGNRNEIQK QIKQKEDAIK       300
     YLARKYSNDK NNKKNLFRIN IPIFNSQTNT EEDTNNSEEL PSLSSEEIER CLYSLCDYNT       360
     HIKMFCQPCE IMIQYLKSFY DPNDRNSPYS LSIETGKQGS RLTHSHSRQY MYVLQTLYLW       420
     REIGEHMFFL WTCAENDMLD LKNPYRLIDT GQGLNRMQSG HTVLGVMRKI LHNVQKKVGG       480
     WVGSSMIHMG DTNIPNTFMF IDKYTQVPRI LNPIVLCLQE IDELYESTPA MKNYINTEFN       540
     GAHNLKMMIT CDFFRHGFDG SGGDNFNEAG SCIDGRLTSA WNWCSKIEKK KYFPIFLLTG       600
     FVGFDGTF                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page