(data stored in ACNUC9543 zone)

EMBL: AL844507.PE112

AL844507.PE112       Location/Qualifiers
FT   CDS             complement(join(582983..586525,586864..586953))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0091:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV1"
FT                   /protein_id="CAD51259.1"
FT                   /translation="MNNVIIFLLLLINFGTKVYGDDNGEHSANNINGKEEEVEDRWKMY
FT                   ALETNPFLDLKHPNFNGHFIRSIDEYYVYETKTYNEYMKERYKNLENNNTFTKKQFHCA
FT                   LAVFNHGRPNPKQTNDYKIWSAQGNILLNEVMHKKKYDKFIIYAPFVSLYNFLGKEGIH
FT                   SHINFAYIIVSRLALTIKNALNDDSCHTYDLYLHGHCFGGNIIRIISSLSKDLWKIFQR
FT                   EVINFKIERETLAIIDSNFHLTLKDINIVTDSDSIEVRKDPYFKKDRFYLYKDFKYKES
FT                   NKPISETFDDVFDDADIGYHRLKDLDNPENTNNAHQVSDEDDNLLRPIKRLHFYLLNKK
FT                   INLHSITVTGPPLSGTFSKMEDINVGHQGFFKQKYIVKYLPYYLKRATMHKFRDVEEVL
FT                   LIYNSELFCLLTVHEKFSYDYTNNLGSLMTFFKSVNFYSDLDNDEIVSMHASLALHSPL
FT                   HMRSLTYYLLNFRNEYYHRAFRIPSHLSDINVSNNYPFFEYLKNNNVCSSMSSRHIEQF
FT                   ISYVNEAINFNQKPKPLIPQRVIYKNPYLEHFVLPYIPDKSIYTPHTILGTGRTYLLLY
FT                   TFDIYKHIAGSAFSNANVLTNDKELLYDSDPFIYYNWTSHVGDQNNVQTNYFMQDIYVF
FT                   SDNVNMNIVDNLFNIFTSTHLVKFFIFNKNHSADVYKSLYRTVEKFALPMVDIVLRKQR
FT                   KKYIEYPFLKNDKFNDEENLVYEYINNYTNYLKNFSFNNSKVYISNDNFITNHETFKKY
FT                   HTEGINTLKEQLSSLHKFAQENKTFYEMKKKFESMHNMNKINSSNNESFNEKELQEMYE
FT                   EYDDFNNIEKPTQDETDNSNEENKSKLDVNYHGIYLLIKRTLSLKEAFQSLKSYNSSYY
FT                   NVKYIEFIIKNSYLEHVDDNISNIDDVSSCLFNHDDDISLGYIAKYCNYNQRLYFNIKK
FT                   HYISRDIFTVPKLKYCEKPKYKHLKICENVILLKFYFRSDLETLLSNLNNKELKRMTEM
FT                   KESVEAGIGKENIFSLTNDSLVTLFHHRNDDITNLPVNACFKLSSISNMNDFFFKKNNV
FT                   ENSSSTKNNGNNLSENIFCTQVTLPVILNKLTIKSINDIYLRAISNVMKYKEFKNIFQL
FT                   SEDEEPYDSFVYFFDKFTYIYNVRTFYQNYNEIETFSTPQNLKWNYFYYLLKNGLNTDY
FT                   NNENFLQNFFYGEHANLVKPLRENILKSFLKHFTVFFYLFKVDE"
     MNNVIIFLLL LINFGTKVYG DDNGEHSANN INGKEEEVED RWKMYALETN PFLDLKHPNF        60
     NGHFIRSIDE YYVYETKTYN EYMKERYKNL ENNNTFTKKQ FHCALAVFNH GRPNPKQTND       120
     YKIWSAQGNI LLNEVMHKKK YDKFIIYAPF VSLYNFLGKE GIHSHINFAY IIVSRLALTI       180
     KNALNDDSCH TYDLYLHGHC FGGNIIRIIS SLSKDLWKIF QREVINFKIE RETLAIIDSN       240
     FHLTLKDINI VTDSDSIEVR KDPYFKKDRF YLYKDFKYKE SNKPISETFD DVFDDADIGY       300
     HRLKDLDNPE NTNNAHQVSD EDDNLLRPIK RLHFYLLNKK INLHSITVTG PPLSGTFSKM       360
     EDINVGHQGF FKQKYIVKYL PYYLKRATMH KFRDVEEVLL IYNSELFCLL TVHEKFSYDY       420
     TNNLGSLMTF FKSVNFYSDL DNDEIVSMHA SLALHSPLHM RSLTYYLLNF RNEYYHRAFR       480
     IPSHLSDINV SNNYPFFEYL KNNNVCSSMS SRHIEQFISY VNEAINFNQK PKPLIPQRVI       540
     YKNPYLEHFV LPYIPDKSIY TPHTILGTGR TYLLLYTFDI YKHIAGSAFS NANVLTNDKE       600
     LLYDSDPFIY YNWTSHVGDQ NNVQTNYFMQ DIYVFSDNVN MNIVDNLFNI FTSTHLVKFF       660
     IFNKNHSADV YKSLYRTVEK FALPMVDIVL RKQRKKYIEY PFLKNDKFND EENLVYEYIN       720
     NYTNYLKNFS FNNSKVYISN DNFITNHETF KKYHTEGINT LKEQLSSLHK FAQENKTFYE       780
     MKKKFESMHN MNKINSSNNE SFNEKELQEM YEEYDDFNNI EKPTQDETDN SNEENKSKLD       840
     VNYHGIYLLI KRTLSLKEAF QSLKSYNSSY YNVKYIEFII KNSYLEHVDD NISNIDDVSS       900
     CLFNHDDDIS LGYIAKYCNY NQRLYFNIKK HYISRDIFTV PKLKYCEKPK YKHLKICENV       960
     ILLKFYFRSD LETLLSNLNN KELKRMTEMK ESVEAGIGKE NIFSLTNDSL VTLFHHRNDD      1020
     ITNLPVNACF KLSSISNMND FFFKKNNVEN SSSTKNNGNN LSENIFCTQV TLPVILNKLT      1080
     IKSINDIYLR AISNVMKYKE FKNIFQLSED EEPYDSFVYF FDKFTYIYNV RTFYQNYNEI      1140
     ETFSTPQNLK WNYFYYLLKN GLNTDYNNEN FLQNFFYGEH ANLVKPLREN ILKSFLKHFT      1200
     VFFYLFKVDE                                                             1210
//

If you have problems or comments...

PBIL Back to PBIL home page