(data stored in ACNUC9543 zone)

EMBL: AL844507.PE114

AL844507.PE114       Location/Qualifiers
FT   CDS             complement(593649..595412)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.102:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV3"
FT                   /protein_id="CAD51257.1"
FT                   /translation="MIRKRLQYLKKDYLKYQYRNIISSSIKKRKQNYKGESLNLYVAFN
FT                   YNINLCHERFDKNIYLYDVNSTIFKLSKYIHKFKKYIKNQTTKKKGYEKNDKYNYKIEQ
FT                   LFMCYISLHNNINRYIFLRLTRDVLNFPPLKEKIINDKKYYEYLLYEIIKCGQENKVDK
FT                   IHFYEYVIKIISSFLLNSTLFFNELFEREFFLDFLNLIKKEDINNYINNFTYLLSCISL
FT                   YKRTLKKNNTFHNNKDIILSSKFLSENNSNILIEKKKMELLLDSLHIILQIFDKIQNYH
FT                   YFKQIDICNIFDFLNEFKSFHKIKICILINIHKYLIPSSDMKHLCLLLYLITSNKNNNN
FT                   NKNNRNICNEYIQQNAYKYIYNIIFLRRNELYDIKNWNLFLLSLIKYKKNERTNKIMRK
FT                   GKIKNVKMIKINEKINDKINEKKNGHINEKINDKINDKINDKINDKINEKIYEKINRHT
FT                   NKISLVLINGETNKTTNMSSRSPKKRNYIKYNKKFELCLNVKNSYMNKKKKYKERILYF
FT                   SIKNYFMQLIEQEKKKIINPKYIKTFYEYFSFYHIKKNCIRKKNYISPLVLIQNYESEK
FT                   EKQKKKKNNIC"
     MIRKRLQYLK KDYLKYQYRN IISSSIKKRK QNYKGESLNL YVAFNYNINL CHERFDKNIY        60
     LYDVNSTIFK LSKYIHKFKK YIKNQTTKKK GYEKNDKYNY KIEQLFMCYI SLHNNINRYI       120
     FLRLTRDVLN FPPLKEKIIN DKKYYEYLLY EIIKCGQENK VDKIHFYEYV IKIISSFLLN       180
     STLFFNELFE REFFLDFLNL IKKEDINNYI NNFTYLLSCI SLYKRTLKKN NTFHNNKDII       240
     LSSKFLSENN SNILIEKKKM ELLLDSLHII LQIFDKIQNY HYFKQIDICN IFDFLNEFKS       300
     FHKIKICILI NIHKYLIPSS DMKHLCLLLY LITSNKNNNN NKNNRNICNE YIQQNAYKYI       360
     YNIIFLRRNE LYDIKNWNLF LLSLIKYKKN ERTNKIMRKG KIKNVKMIKI NEKINDKINE       420
     KKNGHINEKI NDKINDKIND KINDKINEKI YEKINRHTNK ISLVLINGET NKTTNMSSRS       480
     PKKRNYIKYN KKFELCLNVK NSYMNKKKKY KERILYFSIK NYFMQLIEQE KKKIINPKYI       540
     KTFYEYFSFY HIKKNCIRKK NYISPLVLIQ NYESEKEKQK KKKNNIC                     587
//

If you have problems or comments...

PBIL Back to PBIL home page