(data stored in ACNUC9543 zone)

EMBL: AL844507.PE115

AL844507.PE115       Location/Qualifiers
FT   CDS             join(596190..596279,596438..596587,596715..599725,
FT                   599817..599884,600017..600140,600241..600328)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811900"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.101:mRNA"
FT                   /db_xref="GOA:C0H4U1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004170"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U1"
FT                   /protein_id="CAX64117.1"
FT                   /translation="MLFTKIYLLFVFVLYLVSAFIKRQWVPNNYIYFKTDTYYKRRKKK
FT                   MLEFRVKNHKDNDIDPYIPYIYKDIAPVLKEYADDEYSYKQLVNAYFPETIEREKKIKT
FT                   EGKKYFTNLKKIEEQKKLLEDSKEKSDDASEKIDGAIKKSDKSINKSDKDNKKLNSIED
FT                   VEKAMHEKLIKNDVSNFEHISDIKDHKKKNKILDDTYDIIEDSLKDIYMNSNVNKEEDT
FT                   NNINYIELAKKEKNMLYDKLINNHSIVSDSNTFDLFGVFYDNKNYKDEKKLVAEMDKII
FT                   NLEPFKSNNDSNLLEIIDTILKKNKIPIHVRNFLIKYRDIAKKISDANEKKNKTQSTSE
FT                   GNDYTDNDINIFNTNDKEKDEKYKEFLKDLNKVIMSIHNNLNNEKLLKREYNFLDELYE
FT                   DYKHHLKKMHIKRNRLEPQRNNYDFLTFLHEHYEKYYFLKYGQFDYNFNEKINEIKKKI
FT                   EKDDQKKKQELDVQPITHKDTINENKNDDNDDNNIHNNKIHSDNKNNVNNDNINDEVSI
FT                   HTFEPKMSSAHINNNIKNNKNESVNQIKESKKLKKHILIDMIRNYEKQMYDIYKPDNSI
FT                   TNAYGFNNYIDNEKYDKEINLTLNKFSILNYDSKEEPKVYEKLYVGKLIFGEIFKIEND
FT                   FAYVDINYSCYAEIHVDQLPYNISNIREVFKKKDKLIFEIYKMYPGKILLTLKNIQKIN
FT                   DLNKILLYKTQGTPFDVKVIAILKNGVTVIYNDITSFIHISALSCKYKIKTEQEELEEK
FT                   INEDLLLNKKIKVFCTDINKLNFSNLIYEQNEQLKNLNVYDVLEVDIIHISKYGLMVKY
FT                   FDVVGLIHVSEISKKKVDNLNDYFKINDKLKGVIVNIDYDNKRFSMSTKILERDGKNII
FT                   DHASKIYSDIPNIISDIKKRNTNLKMHDTNIKNQLLSLIDIYKSDKEKKKDVPTNDDNK
FT                   NATVQMDVNMKEGLSQIKEHKELTTHGDNKENIKDMNSKEDKTSSSNNNNNNNNNKNDY
FT                   DEDPEGSSVITKKDIKKDSPTIENNMDLKKIKPNDEHMCNKNELDIYEDEDEDEEDITD
FT                   DEENSKLSIDIHNQMIPYLLMKQQQNKKEDQVEEKGEIVWNLEDDDFLNSNSPTQSSQF
FT                   TEYQWSYLNDKKWINFSYYINRIMNYYFHIHDDYFTYKEKNVTYEINFSKNIRLDIGTG
FT                   LYNRIRKIKK"
     MLFTKIYLLF VFVLYLVSAF IKRQWVPNNY IYFKTDTYYK RRKKKMLEFR VKNHKDNDID        60
     PYIPYIYKDI APVLKEYADD EYSYKQLVNA YFPETIEREK KIKTEGKKYF TNLKKIEEQK       120
     KLLEDSKEKS DDASEKIDGA IKKSDKSINK SDKDNKKLNS IEDVEKAMHE KLIKNDVSNF       180
     EHISDIKDHK KKNKILDDTY DIIEDSLKDI YMNSNVNKEE DTNNINYIEL AKKEKNMLYD       240
     KLINNHSIVS DSNTFDLFGV FYDNKNYKDE KKLVAEMDKI INLEPFKSNN DSNLLEIIDT       300
     ILKKNKIPIH VRNFLIKYRD IAKKISDANE KKNKTQSTSE GNDYTDNDIN IFNTNDKEKD       360
     EKYKEFLKDL NKVIMSIHNN LNNEKLLKRE YNFLDELYED YKHHLKKMHI KRNRLEPQRN       420
     NYDFLTFLHE HYEKYYFLKY GQFDYNFNEK INEIKKKIEK DDQKKKQELD VQPITHKDTI       480
     NENKNDDNDD NNIHNNKIHS DNKNNVNNDN INDEVSIHTF EPKMSSAHIN NNIKNNKNES       540
     VNQIKESKKL KKHILIDMIR NYEKQMYDIY KPDNSITNAY GFNNYIDNEK YDKEINLTLN       600
     KFSILNYDSK EEPKVYEKLY VGKLIFGEIF KIENDFAYVD INYSCYAEIH VDQLPYNISN       660
     IREVFKKKDK LIFEIYKMYP GKILLTLKNI QKINDLNKIL LYKTQGTPFD VKVIAILKNG       720
     VTVIYNDITS FIHISALSCK YKIKTEQEEL EEKINEDLLL NKKIKVFCTD INKLNFSNLI       780
     YEQNEQLKNL NVYDVLEVDI IHISKYGLMV KYFDVVGLIH VSEISKKKVD NLNDYFKIND       840
     KLKGVIVNID YDNKRFSMST KILERDGKNI IDHASKIYSD IPNIISDIKK RNTNLKMHDT       900
     NIKNQLLSLI DIYKSDKEKK KDVPTNDDNK NATVQMDVNM KEGLSQIKEH KELTTHGDNK       960
     ENIKDMNSKE DKTSSSNNNN NNNNNKNDYD EDPEGSSVIT KKDIKKDSPT IENNMDLKKI      1020
     KPNDEHMCNK NELDIYEDED EDEEDITDDE ENSKLSIDIH NQMIPYLLMK QQQNKKEDQV      1080
     EEKGEIVWNL EDDDFLNSNS PTQSSQFTEY QWSYLNDKKW INFSYYINRI MNYYFHIHDD      1140
     YFTYKEKNVT YEINFSKNIR LDIGTGLYNR IRKIKK                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page