(data stored in ACNUC9543 zone)

EMBL: AL844507.PE116

AL844507.PE116       Location/Qualifiers
FT   CDS             complement(join(600525..600611,600895..602247))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812000"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.100:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV5"
FT                   /protein_id="CAD51255.1"
FT                   /translation="MILHRVIKSFFSSDLNVSKLLRKKGILFENVKRENCVKDLIVKFM
FT                   ELKGVPINEDDIHIMKNILCRPTGRIMILIDNLKKQNFNFNFDMYEKKEEQNEREHFKD
FT                   KMKTNNIKNGQVIKENEKNKSDNKDIMNITNNNDDDKTNIIYNKEEYYKLKTLFKDCKI
FT                   HLCDDYEIEKFVEECERFLRFTDDIKRISKFENLDKIITIINIPSCYGRKELSEIIYTA
FT                   CNVRIELNNIIFRFKKNGIQSDCAYILCNNIKDANIIIHTIQEYPVAKKYHLTEFYGTA
FT                   FLYASKNNLFISSEKLDYITIFSKYKIFTCGWHKDISIKEFESFLITLKIFPKKIIKIN
FT                   YSKNNILKNNENKPDEHSNDKTLREHICDNNINQLNQTNPNHILINIEEESSSHNDNKS
FT                   KESNEQNDLNTSSFILFFENMRMTKKVFTKFERLKKKWKMSASNNFYAYPKIPDIHFSD
FT                   DIEYMDENEYEDSDLDEEIEY"
     MILHRVIKSF FSSDLNVSKL LRKKGILFEN VKRENCVKDL IVKFMELKGV PINEDDIHIM        60
     KNILCRPTGR IMILIDNLKK QNFNFNFDMY EKKEEQNERE HFKDKMKTNN IKNGQVIKEN       120
     EKNKSDNKDI MNITNNNDDD KTNIIYNKEE YYKLKTLFKD CKIHLCDDYE IEKFVEECER       180
     FLRFTDDIKR ISKFENLDKI ITIINIPSCY GRKELSEIIY TACNVRIELN NIIFRFKKNG       240
     IQSDCAYILC NNIKDANIII HTIQEYPVAK KYHLTEFYGT AFLYASKNNL FISSEKLDYI       300
     TIFSKYKIFT CGWHKDISIK EFESFLITLK IFPKKIIKIN YSKNNILKNN ENKPDEHSND       360
     KTLREHICDN NINQLNQTNP NHILINIEEE SSSHNDNKSK ESNEQNDLNT SSFILFFENM       420
     RMTKKVFTKF ERLKKKWKMS ASNNFYAYPK IPDIHFSDDI EYMDENEYED SDLDEEIEY        479
//

If you have problems or comments...

PBIL Back to PBIL home page