(data stored in ACNUC9543 zone)

EMBL: AL844507.PE117

AL844507.PE117       Location/Qualifiers
FT   CDS             604923..612878
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812100"
FT                   /product="proteasome activator complex subunit 4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0089:mRNA"
FT                   /db_xref="GOA:Q8IAV6"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021843"
FT                   /db_xref="InterPro:IPR035309"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV6"
FT                   /protein_id="CAD51254.1"
FT                   /translation="MLDVFRELNNYTNFLPKNIKANVNKEKYEILSEIKRIVFLKKRNS
FT                   YNVASVIKLFNTYEVINTKKYKSFHFYIFMIRYLWNSLQNKSISPNLKCYICQCISSIF
FT                   KNIKKYILYDFFFEYDRKLILKEENGKNENVAKCVESHFDKGMKSDCTNNSYAYMSDNY
FT                   YDEYQNLHEGSELDSSINDNKLNIFNDVYVTCNGIYEKNKKKEDETFLNEEVIINGKDE
FT                   SFRLYIQKCIFNIIDYKYLFNLLYEYLSNNNNNYINNNNNNNNNNKHDEYSHNAYKSYM
FT                   GAILNLLNHIKYFCYYNIDVHNLLVEFALNNDYSYLYEEYVDSNDKEGLFSEEDYFDKN
FT                   NVIFLINRKLNERKNIHNNNDDYNTNCDEEYIKADNIININKDGQNDSCDMLEKNTNVK
FT                   NIDNITNEYDNTLMEKRHVQNNYLNIDKSVCDIKDLEVCTRYNTIFLNYVLLSQLSSHD
FT                   LCYKLIKYKKVLYLYKKIRRFNWNCINYAFVNIIYKGLKYAYIYNLNIENEMQEILHVI
FT                   YFLFLFYIKLPSNVQLNSSKYFIPEDYNLLVNDNESVVKVISKIFVFLLNKKYKKGNHN
FT                   PSNKNENDPQELLYKFLSTMNEKNFTMTEMNTNNSNTNFMYNNTNGNNNNDNKNDNNND
FT                   NNNDNNNDNNNDNNNDNNNDNNNDNSCDNSLRENFFPIFTNIDTYEYLNIITSLFMPHI
FT                   HPSNIGKHIGNINLFINSFLYCFIRKMKREEIYLKRKNKKTEFCKKMENNKINGTSHLD
FT                   NTNTNNEYLEQKYMNDYVNNFFIMEDDKKFVIEKFMALAVQGMFPKSNKGISLFENILK
FT                   HLCIIDINCLDIFVKKIMDCLMNVNISTQICNCLLSLCLLLPLLIKYKSKYLKDILYVM
FT                   NMGIDICDVYKSFTIFSFLSILFSYISIVKLDTCTNDDYTLAIDEYKKMISLFSEDNKK
FT                   MLNKEDIKKLLIERKELIDYMCYWVYEFFDKILYFIKFSKSQKSKDSKKQNGDNKDNKI
FT                   ENDLYTGLKTTIISLFIHLDHKIVYDLSQRFLNNIELENSKFLSIIPYAISLVDNKKIF
FT                   DLLFNAFYKKLIIKKKKKRIIILSSANNNMNNMNNETSKCQQTSLESQQIEEYYVYTKN
FT                   EYANDDTVKCYLQFLSSLMRRAKNEFLNVEDIYQLIKIYIVEDNISVFKYICKIIYRFL
FT                   EYNFSVTIMDYSCFPINEKMSNKEKLCTAAYWGIPWHVIVYYENIMNHTNVSPNRINHT
FT                   NVLSNRINHTNVLSNQINDTNVSPNRINHTNVLSNQINDTNVTPNQINDTSVSPHKSND
FT                   TNVSPNQINDTNVSPNQINDTTVSPHKSSDTNVSPNQINDTTVSPHKSNDTNELIKWKT
FT                   PLLEDVKVGKKFIFFLLDYLIDLLIQCDIPINTPNILRYIEKRKLDENRRKIEWKFSLT
FT                   YANVISRIYKVIKCIIKPTSFLYPDERYNYNNLLTKCHVINSKLSFVLYVYISEIVITL
FT                   SLHVLKVPANILDMSTFIRACNDNEEKTENSSNEKIVQNMDNKSELKKLKEEFYNIVIK
FT                   NREKDIKADAKVQRKMIKNIHFLLLKCNENANSSLYNEYINSVLSFTYNIYPYSYNYDI
FT                   IKSQYINNIFYLFNERLKQRKKNYAFRGFRKQLCNILFYINLSIYSQVRSYAQNTIKLI
FT                   LPSFKMIKVSFLKTCAFYLKNYIKLYLLSKGDILRKKKTLDDSNDGELKEQNMKRDVIN
FT                   KENISIEKNDEEESAIQNTSEHINNTEFVKESNISNEYDNNINNASINKWSSLKSLNDL
FT                   NNNDYFENKCISSFNGIIVSILNNMGLIKKISTDVYLLKKFLKVIIRILRLDIQKEDIT
FT                   MKCMKLVYSIINNRFIKKSVEEKRKKKKINKLFLCLKEESEKKNNVYSQIVIMSFLICF
FT                   NYFVVENHCEFYFNYLVENLSIKKNVHVYNLAFCGFIKMLKYLNDFHLKGVMPKHIALT
FT                   FETDKIYKNFIDICIYKNLKNKKKNNSMNAIIINLSKIQKPFKGFTQISETYLKDFYSY
FT                   YVFFEFLVNIQNTYFEEMQEKEARLHTMENLMRDENYNKDITEEQTIKENVDAHIVECI
FT                   STHNGNDNGEYISDHLNKHNLEEKEGNHISCNENMISDKANDSGDNNNNNNNNNEKEPR
FT                   NDITYSENLNVKNCKLKYFEMVLIILKELQMDIHYSDNEYKCAFISILCPLLLSIRKLR
FT                   NKEESEDIIKVIVNLLEKEIAIVNIEVFNVWIYCFHLLFINIKKKYIHVYNKLFDFCLR
FT                   FNVQDISNVTFKKKMQLLDIMLLYSLHKNVYMLDNSLMTLVKLIENDNISVRQIIGDVF
FT                   CYMLYVLYDNKHYEHLKCMYYNILLFLYTSANNVITYLEENSISLSKQSKYIYILETCA
FT                   YLTLTAFNNKCMYVFNNLSIIFLKMFMLSFQLVDVFINGLVSKAINCFLCPSLYLFKFD
FT                   IINSSNNNIQIYDINNNNDNNLKNVGFPEQVHNLNILLEEDIGTLVIKNISNLINKSNW
FT                   KIRNCALQFCYYFHLYYCIFFYNKKENAFLLNMFISLLVDSYIEIQNLSRDILSSVFCY
FT                   YDNKTLQIFSSYFLSILNDHKNLQKLPSISKKTSFKIIDKKKTVSIYALISIVNSFPNY
FT                   IPPWLPNILISVAKLSNSSSHVIKKEIEKCIQNFLRTHKDEWEYKYKQIFTEEQLNILD
FT                   LYKGELNYFT"
     MLDVFRELNN YTNFLPKNIK ANVNKEKYEI LSEIKRIVFL KKRNSYNVAS VIKLFNTYEV        60
     INTKKYKSFH FYIFMIRYLW NSLQNKSISP NLKCYICQCI SSIFKNIKKY ILYDFFFEYD       120
     RKLILKEENG KNENVAKCVE SHFDKGMKSD CTNNSYAYMS DNYYDEYQNL HEGSELDSSI       180
     NDNKLNIFND VYVTCNGIYE KNKKKEDETF LNEEVIINGK DESFRLYIQK CIFNIIDYKY       240
     LFNLLYEYLS NNNNNYINNN NNNNNNNKHD EYSHNAYKSY MGAILNLLNH IKYFCYYNID       300
     VHNLLVEFAL NNDYSYLYEE YVDSNDKEGL FSEEDYFDKN NVIFLINRKL NERKNIHNNN       360
     DDYNTNCDEE YIKADNIINI NKDGQNDSCD MLEKNTNVKN IDNITNEYDN TLMEKRHVQN       420
     NYLNIDKSVC DIKDLEVCTR YNTIFLNYVL LSQLSSHDLC YKLIKYKKVL YLYKKIRRFN       480
     WNCINYAFVN IIYKGLKYAY IYNLNIENEM QEILHVIYFL FLFYIKLPSN VQLNSSKYFI       540
     PEDYNLLVND NESVVKVISK IFVFLLNKKY KKGNHNPSNK NENDPQELLY KFLSTMNEKN       600
     FTMTEMNTNN SNTNFMYNNT NGNNNNDNKN DNNNDNNNDN NNDNNNDNNN DNNNDNNNDN       660
     SCDNSLRENF FPIFTNIDTY EYLNIITSLF MPHIHPSNIG KHIGNINLFI NSFLYCFIRK       720
     MKREEIYLKR KNKKTEFCKK MENNKINGTS HLDNTNTNNE YLEQKYMNDY VNNFFIMEDD       780
     KKFVIEKFMA LAVQGMFPKS NKGISLFENI LKHLCIIDIN CLDIFVKKIM DCLMNVNIST       840
     QICNCLLSLC LLLPLLIKYK SKYLKDILYV MNMGIDICDV YKSFTIFSFL SILFSYISIV       900
     KLDTCTNDDY TLAIDEYKKM ISLFSEDNKK MLNKEDIKKL LIERKELIDY MCYWVYEFFD       960
     KILYFIKFSK SQKSKDSKKQ NGDNKDNKIE NDLYTGLKTT IISLFIHLDH KIVYDLSQRF      1020
     LNNIELENSK FLSIIPYAIS LVDNKKIFDL LFNAFYKKLI IKKKKKRIII LSSANNNMNN      1080
     MNNETSKCQQ TSLESQQIEE YYVYTKNEYA NDDTVKCYLQ FLSSLMRRAK NEFLNVEDIY      1140
     QLIKIYIVED NISVFKYICK IIYRFLEYNF SVTIMDYSCF PINEKMSNKE KLCTAAYWGI      1200
     PWHVIVYYEN IMNHTNVSPN RINHTNVLSN RINHTNVLSN QINDTNVSPN RINHTNVLSN      1260
     QINDTNVTPN QINDTSVSPH KSNDTNVSPN QINDTNVSPN QINDTTVSPH KSSDTNVSPN      1320
     QINDTTVSPH KSNDTNELIK WKTPLLEDVK VGKKFIFFLL DYLIDLLIQC DIPINTPNIL      1380
     RYIEKRKLDE NRRKIEWKFS LTYANVISRI YKVIKCIIKP TSFLYPDERY NYNNLLTKCH      1440
     VINSKLSFVL YVYISEIVIT LSLHVLKVPA NILDMSTFIR ACNDNEEKTE NSSNEKIVQN      1500
     MDNKSELKKL KEEFYNIVIK NREKDIKADA KVQRKMIKNI HFLLLKCNEN ANSSLYNEYI      1560
     NSVLSFTYNI YPYSYNYDII KSQYINNIFY LFNERLKQRK KNYAFRGFRK QLCNILFYIN      1620
     LSIYSQVRSY AQNTIKLILP SFKMIKVSFL KTCAFYLKNY IKLYLLSKGD ILRKKKTLDD      1680
     SNDGELKEQN MKRDVINKEN ISIEKNDEEE SAIQNTSEHI NNTEFVKESN ISNEYDNNIN      1740
     NASINKWSSL KSLNDLNNND YFENKCISSF NGIIVSILNN MGLIKKISTD VYLLKKFLKV      1800
     IIRILRLDIQ KEDITMKCMK LVYSIINNRF IKKSVEEKRK KKKINKLFLC LKEESEKKNN      1860
     VYSQIVIMSF LICFNYFVVE NHCEFYFNYL VENLSIKKNV HVYNLAFCGF IKMLKYLNDF      1920
     HLKGVMPKHI ALTFETDKIY KNFIDICIYK NLKNKKKNNS MNAIIINLSK IQKPFKGFTQ      1980
     ISETYLKDFY SYYVFFEFLV NIQNTYFEEM QEKEARLHTM ENLMRDENYN KDITEEQTIK      2040
     ENVDAHIVEC ISTHNGNDNG EYISDHLNKH NLEEKEGNHI SCNENMISDK ANDSGDNNNN      2100
     NNNNNEKEPR NDITYSENLN VKNCKLKYFE MVLIILKELQ MDIHYSDNEY KCAFISILCP      2160
     LLLSIRKLRN KEESEDIIKV IVNLLEKEIA IVNIEVFNVW IYCFHLLFIN IKKKYIHVYN      2220
     KLFDFCLRFN VQDISNVTFK KKMQLLDIML LYSLHKNVYM LDNSLMTLVK LIENDNISVR      2280
     QIIGDVFCYM LYVLYDNKHY EHLKCMYYNI LLFLYTSANN VITYLEENSI SLSKQSKYIY      2340
     ILETCAYLTL TAFNNKCMYV FNNLSIIFLK MFMLSFQLVD VFINGLVSKA INCFLCPSLY      2400
     LFKFDIINSS NNNIQIYDIN NNNDNNLKNV GFPEQVHNLN ILLEEDIGTL VIKNISNLIN      2460
     KSNWKIRNCA LQFCYYFHLY YCIFFYNKKE NAFLLNMFIS LLVDSYIEIQ NLSRDILSSV      2520
     FCYYDNKTLQ IFSSYFLSIL NDHKNLQKLP SISKKTSFKI IDKKKTVSIY ALISIVNSFP      2580
     NYIPPWLPNI LISVAKLSNS SSHVIKKEIE KCIQNFLRTH KDEWEYKYKQ IFTEEQLNIL      2640
     DLYKGELNYF T                                                           2651
//

If you have problems or comments...

PBIL Back to PBIL home page