(data stored in ACNUC9543 zone)

EMBL: AL844507.PE122

AL844507.PE122       Location/Qualifiers
FT   CDS             complement(626069..628945)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812500"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0086:mRNA"
FT                   /db_xref="GOA:Q8IAW1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035542"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAW1"
FT                   /protein_id="CAD51249.1"
FT                   /translation="MFFNFSRKKKSEERLEEERSNTCEETEQVEETSNNKRGRKQKEKD
FT                   EKAKSVEDNLDEEYDVGKNKTQEKKKRKYTRKTGATATTNNTTTTTKRGRKSKKEKDEE
FT                   IEENEKKNEVKDENVNNIGKSDDNEEKDNKENKDENYEMKITEELKDKDAKASALTLEI
FT                   LGDIPDADMKPPENILFVCKLNPVTEEEDLKIIFSRFGNIKSCKIIKDKVTNNSLQYGF
FT                   IEFEKKEDCLNAYFEMDNVVIDDRRIHVDFCQSLSKYKNEYLKDNMNNDNVNNKKQKWD
FT                   EATCKKEENNEDNIRVFKYESDHNTKEPNNDRNKKKDSKEDLENLKYKKYDNDNKRNYF
FT                   SKYKYDKDYNYNNNDKKFSHHYYRNNSYKYKNSHNHNFMYSKNQYYRKNLNYYDNKNKY
FT                   YKNIHNAAIGKRNYSPTDMIKRNNYNRRNSRSFSPRDRRTRGEGNMKDYDRYKKKEHEH
FT                   KNTQEHIDNEQKKQNEDEISNYENKTNDEHKTNEESYKRSIEGSTKNENLKNDKVTKSA
FT                   SKSFDKPDIYDVDYNDDISDYEKEKNTKNEKRSESNSTFKVSSRRSNRRTSQNSSINNK
FT                   TEHESYNRKESNKYYENKKRKYNDYQNKDNTNYHYPVKEYDNDRKGKHPSYAEEDRNYK
FT                   RRNYEDKYIDKYKDKFPDKYRDKFSDKYTDKNDNKYYNNNNMRKYSKYNDGYVGDNKKY
FT                   SKREDLYNYYDEKNKYNKHDLYDKEYYNKRKYSNYNTYNNNDNYNNKDFKSYREEKNTN
FT                   YHRTDDNKNYHHTDDFNKSYKHKDSKINDDHINISSKYHPNNDYRKPYDNGKDKMPYYS
FT                   KHSRISHKQDDYKYADNYRSKFNNKSYEERRLVNHRDRSLDHEKDYKYSRNNKDDNYHN
FT                   FNKKDTRRNHSKSFSESRYDYSNKYNDRKKNYKNDKYDKKVKTNNKNHDSPYERNSVSI
FT                   SKDSYTNNKKKNSYTLKTESVKSFVSRE"
     MFFNFSRKKK SEERLEEERS NTCEETEQVE ETSNNKRGRK QKEKDEKAKS VEDNLDEEYD        60
     VGKNKTQEKK KRKYTRKTGA TATTNNTTTT TKRGRKSKKE KDEEIEENEK KNEVKDENVN       120
     NIGKSDDNEE KDNKENKDEN YEMKITEELK DKDAKASALT LEILGDIPDA DMKPPENILF       180
     VCKLNPVTEE EDLKIIFSRF GNIKSCKIIK DKVTNNSLQY GFIEFEKKED CLNAYFEMDN       240
     VVIDDRRIHV DFCQSLSKYK NEYLKDNMNN DNVNNKKQKW DEATCKKEEN NEDNIRVFKY       300
     ESDHNTKEPN NDRNKKKDSK EDLENLKYKK YDNDNKRNYF SKYKYDKDYN YNNNDKKFSH       360
     HYYRNNSYKY KNSHNHNFMY SKNQYYRKNL NYYDNKNKYY KNIHNAAIGK RNYSPTDMIK       420
     RNNYNRRNSR SFSPRDRRTR GEGNMKDYDR YKKKEHEHKN TQEHIDNEQK KQNEDEISNY       480
     ENKTNDEHKT NEESYKRSIE GSTKNENLKN DKVTKSASKS FDKPDIYDVD YNDDISDYEK       540
     EKNTKNEKRS ESNSTFKVSS RRSNRRTSQN SSINNKTEHE SYNRKESNKY YENKKRKYND       600
     YQNKDNTNYH YPVKEYDNDR KGKHPSYAEE DRNYKRRNYE DKYIDKYKDK FPDKYRDKFS       660
     DKYTDKNDNK YYNNNNMRKY SKYNDGYVGD NKKYSKREDL YNYYDEKNKY NKHDLYDKEY       720
     YNKRKYSNYN TYNNNDNYNN KDFKSYREEK NTNYHRTDDN KNYHHTDDFN KSYKHKDSKI       780
     NDDHINISSK YHPNNDYRKP YDNGKDKMPY YSKHSRISHK QDDYKYADNY RSKFNNKSYE       840
     ERRLVNHRDR SLDHEKDYKY SRNNKDDNYH NFNKKDTRRN HSKSFSESRY DYSNKYNDRK       900
     KNYKNDKYDK KVKTNNKNHD SPYERNSVSI SKDSYTNNKK KNSYTLKTES VKSFVSRE         958
//

If you have problems or comments...

PBIL Back to PBIL home page