(data stored in ACNUC9543 zone)

EMBL: AL844507.PE123

AL844507.PE123       Location/Qualifiers
FT   CDS             complement(join(631584..631924,632079..632229))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812600"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /EC_number="2.3.2.23"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0085:mRNA"
FT                   /db_xref="GOA:Q8IAW2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAW2"
FT                   /protein_id="CAD51248.1"
FT                   /translation="MSNLAKKRLIRDFRKLQTDSPFGVSGSPIGNDIMKWRAVIFGPAD
FT                   TPWEGGTFHLELLFGNEYPNRPPKVKFLTKMFHPNIYMDGNICIDILQKHWSPIYDISA
FT                   ILTSIQSLLSDPNPNSPANQEAALLFVENRIEYNRRIKNCVKESFNFIEQKAEEDAEKS
FT                   "
     MSNLAKKRLI RDFRKLQTDS PFGVSGSPIG NDIMKWRAVI FGPADTPWEG GTFHLELLFG        60
     NEYPNRPPKV KFLTKMFHPN IYMDGNICID ILQKHWSPIY DISAILTSIQ SLLSDPNPNS       120
     PANQEAALLF VENRIEYNRR IKNCVKESFN FIEQKAEEDA EKS                         163
//

If you have problems or comments...

PBIL Back to PBIL home page