(data stored in ACNUC9543 zone)

EMBL: AL844507.PE126

AL844507.PE126       Location/Qualifiers
FT   CDS             complement(join(636628..637715,637843..641458))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.97:mRNA"
FT                   /db_xref="GOA:Q8IAW4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAW4"
FT                   /protein_id="CAD51246.1"
FT                   /translation="MNIICDEPYFIDNHNELFCPVNCPFISSNDVWKCIGICTSKEKCS
FT                   LYNSSLTFADEETNKCLPCLVSGCIRCIKSTLKKGSKSFLSISDNLPNICLECIKGYRL
FT                   SRDRTKCSLIYEEFITRSCGFLVLIFFLSFIFLFIYFYKNRDKINILLFKLAYQYRTLS
FT                   KFRNNLIYGRPLYPLNMKLSKNDIGGIGLMLYFRYLTFLNFLSILFIVVSLFDVYLPFD
FT                   ELIQTYRNVESTTSLEKCKNLKNYISHNISPLIHMKNLDWMSLDMFNMTIRFKHHMIFS
FT                   SFVRYILCMIITFIFIYNQRKFYNIKKNTSYCMMDYALSIANFSSSLSSHDIQNFFENL
FT                   IKKKIIGISSCYDFYRQKDLVFNLIEEQIEWADFKMKLYRNYEEWKKENKKKIVSIYAK
FT                   TNKNINVISQKEILNDNTISTNLINGNDINLYEGNDNYLIEKLQHLKRYELFPFYEVDI
FT                   HTDDINFVNTNHSNDSKMFIQKSTFNSIQTIHMDSKNPWNIYNNNKMNNNNESIIFSEK
FT                   LLYDHPLILNKEWNEEMKKLKYSPYYKNDDTNYNDKNYDHEYHDNKYYNDNIYNDMYYN
FT                   DNIYNDMYYNNNIYNDMYYNNNIYNDNIYNNSGRNSTADKNIILNEKKNNFHMEDYFFK
FT                   DISNKLFDLCSKEYKNISKKKKNILNDYIRKSIFSYFQTKIDQDNRVRNGYIPFCMCNN
FT                   TEGLFLKRDLSKDMKVVRNIKCCNKAYVIFKTTKDLNLAYSIINKYIEKIEKKKKKIKK
FT                   KNKTKKEKMTKEKMTNDKMTNDKMTNDKMTNDKMTNDKMTNDKITKEKKIKDKMINVLN
FT                   KGKYKLYSFLFSPILFLKNLFNDEKIHNNITYKLLSNNNSNNNNILWNNKINDKKIYNE
FT                   INIKWENKKPKGRIQNNLFLFFQNNPFQVNKCDVEPIDITWQNISNNTFIIPIMIIKIT
FT                   MSILILFFLILLWSIIFYGPYAIYALHHASIIEKQKKQEILFNVLISLILGIFIGFGNF
FT                   LLTFLTTLIGNFMKFDKKQSTDSFVFCVNSIFQLLNFLLNVLITHLTNAGGDNKIRSFF
FT                   LFFPNHLFVHLKSKNIILGEEYSFGRSLNYNIIPFITLFPTLFSFFGIYILPFLYKSML
FT                   ILFCSNTTIKKAEKLIQCPECNLHYRYSEAVISFTVTLLLFFFTHDKYNTSFTYVLLFL
FT                   SYLFIKYRDTYLFLRETKITYYYNTFLFDTVIAFWSLPTGILAILPFYWMWRSHKTSIL
FT                   TIVSVFFAHIFIYFIICNAIRKNLNENISMNDVSYHEVAQMKAYNWFNTNPVYVLKQYS
FT                   KKRGVQHPTNSYHKNEKNEKNEKDIMEFKMKKDPTTKNDKSKKYNFLDSYRSIFFNQEI
FT                   KPKERETHDTIIKMDDLQNSGDIQNMSYHILDTFNSKNNYDKNKDHFNQRELKKKQGSN
FT                   KQISRNIKSSDDYNIYMQNNNNENYSDDNTTNIPYTYKTKNKNSIEYKIKNEYLSDDFI
FT                   IRNRKGNKNIFNNIKSDYGNKFVRIKRKNIKQNKKKRLRNKTSKINRPRQKDLIYYVIG
FT                   KEYLQGDRFANYTKDYNELYDFIYRIYLSLSSTAYKIKMFPLLAKRK"
     MNIICDEPYF IDNHNELFCP VNCPFISSND VWKCIGICTS KEKCSLYNSS LTFADEETNK        60
     CLPCLVSGCI RCIKSTLKKG SKSFLSISDN LPNICLECIK GYRLSRDRTK CSLIYEEFIT       120
     RSCGFLVLIF FLSFIFLFIY FYKNRDKINI LLFKLAYQYR TLSKFRNNLI YGRPLYPLNM       180
     KLSKNDIGGI GLMLYFRYLT FLNFLSILFI VVSLFDVYLP FDELIQTYRN VESTTSLEKC       240
     KNLKNYISHN ISPLIHMKNL DWMSLDMFNM TIRFKHHMIF SSFVRYILCM IITFIFIYNQ       300
     RKFYNIKKNT SYCMMDYALS IANFSSSLSS HDIQNFFENL IKKKIIGISS CYDFYRQKDL       360
     VFNLIEEQIE WADFKMKLYR NYEEWKKENK KKIVSIYAKT NKNINVISQK EILNDNTIST       420
     NLINGNDINL YEGNDNYLIE KLQHLKRYEL FPFYEVDIHT DDINFVNTNH SNDSKMFIQK       480
     STFNSIQTIH MDSKNPWNIY NNNKMNNNNE SIIFSEKLLY DHPLILNKEW NEEMKKLKYS       540
     PYYKNDDTNY NDKNYDHEYH DNKYYNDNIY NDMYYNDNIY NDMYYNNNIY NDMYYNNNIY       600
     NDNIYNNSGR NSTADKNIIL NEKKNNFHME DYFFKDISNK LFDLCSKEYK NISKKKKNIL       660
     NDYIRKSIFS YFQTKIDQDN RVRNGYIPFC MCNNTEGLFL KRDLSKDMKV VRNIKCCNKA       720
     YVIFKTTKDL NLAYSIINKY IEKIEKKKKK IKKKNKTKKE KMTKEKMTND KMTNDKMTND       780
     KMTNDKMTND KMTNDKITKE KKIKDKMINV LNKGKYKLYS FLFSPILFLK NLFNDEKIHN       840
     NITYKLLSNN NSNNNNILWN NKINDKKIYN EINIKWENKK PKGRIQNNLF LFFQNNPFQV       900
     NKCDVEPIDI TWQNISNNTF IIPIMIIKIT MSILILFFLI LLWSIIFYGP YAIYALHHAS       960
     IIEKQKKQEI LFNVLISLIL GIFIGFGNFL LTFLTTLIGN FMKFDKKQST DSFVFCVNSI      1020
     FQLLNFLLNV LITHLTNAGG DNKIRSFFLF FPNHLFVHLK SKNIILGEEY SFGRSLNYNI      1080
     IPFITLFPTL FSFFGIYILP FLYKSMLILF CSNTTIKKAE KLIQCPECNL HYRYSEAVIS      1140
     FTVTLLLFFF THDKYNTSFT YVLLFLSYLF IKYRDTYLFL RETKITYYYN TFLFDTVIAF      1200
     WSLPTGILAI LPFYWMWRSH KTSILTIVSV FFAHIFIYFI ICNAIRKNLN ENISMNDVSY      1260
     HEVAQMKAYN WFNTNPVYVL KQYSKKRGVQ HPTNSYHKNE KNEKNEKDIM EFKMKKDPTT      1320
     KNDKSKKYNF LDSYRSIFFN QEIKPKERET HDTIIKMDDL QNSGDIQNMS YHILDTFNSK      1380
     NNYDKNKDHF NQRELKKKQG SNKQISRNIK SSDDYNIYMQ NNNNENYSDD NTTNIPYTYK      1440
     TKNKNSIEYK IKNEYLSDDF IIRNRKGNKN IFNNIKSDYG NKFVRIKRKN IKQNKKKRLR      1500
     NKTSKINRPR QKDLIYYVIG KEYLQGDRFA NYTKDYNELY DFIYRIYLSL SSTAYKIKMF      1560
     PLLAKRK                                                                1567
//

If you have problems or comments...

PBIL Back to PBIL home page