(data stored in ACNUC9543 zone)

EMBL: AL844507.PE127

AL844507.PE127       Location/Qualifiers
FT   CDS             complement(643086..644885)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813000"
FT                   /product="conserved protein, unknown function"
FT                   /protein_id="VWP74399.1"
FT                   /translation="MSSATQLGISEREYEEALAVEKLFFLSSRERCNYCNYGKSTFVDT
FT                   FNYEFLCDKCSYRSKHKKKIGEDSISYYDVQKLEKKFGDSAYYKQHSNNNKHHHHHHHH
FT                   HNKKSSYSQEKKSKSKNRRSSTRKHIEVVTDSSDSEYDEKFKKKEKKKKKERDRDRDKD
FT                   RDKDKDKDRDRTRDRTRDRTREKSYKDNKDSKYKKKKKYDDSDDDFDDEFSLNDYDPNT
FT                   PGMIGIMNSNNMSNSDYKNNFDNNFNEFDGNHLNYNQMSEHNYHDFNAFNNNINNHIPF
FT                   DNNNNPYSKNNFHLKYMNSPSSDLANINPICSDDFNPMYFNKMNYPNNFNVKLNEDSDI
FT                   NNKMKYNNKMSMVPYDPFDNSSNGESNRYSNAMDNANYYNTTNNMNNMSNMSNMSNLNN
FT                   MNNMSNMNNMNNMSNMSNMNNRLYLLNKRSSLNNNYSPNNIKPLYNQQYSNKNLYNTLN
FT                   HNQNPLNQKMSFDNNIPSNKNKMYQNKKNSTYLLNNNLNKSNSGSGLLHSGNNMNLLCY
FT                   SQQNSLNDMNRFHDNNMYNPDFAPVNVSDKNPFSLHNMISTPNNRKSYNALNSLNSDVS
FT                   NNSISRNSFKALSYPVFDSNKKF"
     MSSATQLGIS EREYEEALAV EKLFFLSSRE RCNYCNYGKS TFVDTFNYEF LCDKCSYRSK        60
     HKKKIGEDSI SYYDVQKLEK KFGDSAYYKQ HSNNNKHHHH HHHHHNKKSS YSQEKKSKSK       120
     NRRSSTRKHI EVVTDSSDSE YDEKFKKKEK KKKKERDRDR DKDRDKDKDK DRDRTRDRTR       180
     DRTREKSYKD NKDSKYKKKK KYDDSDDDFD DEFSLNDYDP NTPGMIGIMN SNNMSNSDYK       240
     NNFDNNFNEF DGNHLNYNQM SEHNYHDFNA FNNNINNHIP FDNNNNPYSK NNFHLKYMNS       300
     PSSDLANINP ICSDDFNPMY FNKMNYPNNF NVKLNEDSDI NNKMKYNNKM SMVPYDPFDN       360
     SSNGESNRYS NAMDNANYYN TTNNMNNMSN MSNMSNLNNM NNMSNMNNMN NMSNMSNMNN       420
     RLYLLNKRSS LNNNYSPNNI KPLYNQQYSN KNLYNTLNHN QNPLNQKMSF DNNIPSNKNK       480
     MYQNKKNSTY LLNNNLNKSN SGSGLLHSGN NMNLLCYSQQ NSLNDMNRFH DNNMYNPDFA       540
     PVNVSDKNPF SLHNMISTPN NRKSYNALNS LNSDVSNNSI SRNSFKALSY PVFDSNKKF        599
//

If you have problems or comments...

PBIL Back to PBIL home page