(data stored in SCRATCH zone)

EMBL: AL844507.PE128

AL844507.PE128       Location/Qualifiers
FT   CDS             complement(647316..649304)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813100"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0813100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0082:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAW6"
FT                   /protein_id="CAD51244.1"
FT                   /translation="MSGNVKYYYDIVTSKLYFFDILSVQWKEYNEDTFNDGYAQVNNTS
FT                   KYNEKDSVDKYSFYNTRHVQHTNKKGYKEIVHKKKDSNNQLYELTNNVSNKIMRSGNNL
FT                   IKKLKESFNISDPSTSQNDTSNVNAQSEKVIKEMSDHIYPSQNDIRNYNNENKVEYDDS
FT                   LNNYYEEEEEEEEKDNEEEIINHNSNTKEEDGEYQNNIHNNDNNTYDYNNTANNLSNIY
FT                   TDEYEQYNENGNENVYKESGNYEINDKNYYDENMNYYEEAENYDTDYKNDYEENGYYYE
FT                   QDMKNYNKENNYEYDETKKYNNNNNNNDDDDDDDDNIHSNNKTEQTDSKDTQNTKQIFY
FT                   SYEKQHKESTNPYDKIYLNEKKEDTYEYSPVVEKNEEYIKDREYGENKNKLKEYNDSTL
FT                   LKKLNKEEIQKKNSANSRDSSPSSCGSNKLSERINSLINESYSIHSLTPQHRSYLTNSS
FT                   YYYHSNHYYSNNSLSKRGSSNLIENLLSHSGTKSDNFQSFNEAENNDGKDNHTEETIMN
FT                   KKTSKVNFENIKDSKEQTFDKNKKAYKENEESNINHETNDTSEIPFVRRATRTLTFKNQ
FT                   GGLTGCLKTVHKKKQELMLSSPNGVSDIDIKIANLKRRARELAQRYKSKEYSNHDQEKN
FT                   ENMKTKFEDIVLQAQKQKREIQQMQNI"
     MSGNVKYYYD IVTSKLYFFD ILSVQWKEYN EDTFNDGYAQ VNNTSKYNEK DSVDKYSFYN        60
     TRHVQHTNKK GYKEIVHKKK DSNNQLYELT NNVSNKIMRS GNNLIKKLKE SFNISDPSTS       120
     QNDTSNVNAQ SEKVIKEMSD HIYPSQNDIR NYNNENKVEY DDSLNNYYEE EEEEEEKDNE       180
     EEIINHNSNT KEEDGEYQNN IHNNDNNTYD YNNTANNLSN IYTDEYEQYN ENGNENVYKE       240
     SGNYEINDKN YYDENMNYYE EAENYDTDYK NDYEENGYYY EQDMKNYNKE NNYEYDETKK       300
     YNNNNNNNDD DDDDDDNIHS NNKTEQTDSK DTQNTKQIFY SYEKQHKEST NPYDKIYLNE       360
     KKEDTYEYSP VVEKNEEYIK DREYGENKNK LKEYNDSTLL KKLNKEEIQK KNSANSRDSS       420
     PSSCGSNKLS ERINSLINES YSIHSLTPQH RSYLTNSSYY YHSNHYYSNN SLSKRGSSNL       480
     IENLLSHSGT KSDNFQSFNE AENNDGKDNH TEETIMNKKT SKVNFENIKD SKEQTFDKNK       540
     KAYKENEESN INHETNDTSE IPFVRRATRT LTFKNQGGLT GCLKTVHKKK QELMLSSPNG       600
     VSDIDIKIAN LKRRARELAQ RYKSKEYSNH DQEKNENMKT KFEDIVLQAQ KQKREIQQMQ       660
     NI                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page