(data stored in ACNUC9543 zone)

EMBL: AL844507.PE130

AL844507.PE130       Location/Qualifiers
FT   CDS             join(656078..656087,656693..657630)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813300"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0813300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.95:mRNA"
FT                   /db_xref="GOA:C0H4U4"
FT                   /db_xref="InterPro:IPR041232"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U4"
FT                   /protein_id="CAX64120.1"
FT                   /translation="MFYGKVVKPDETVVPEVKDGYSVIHLSRACLNNPEHEGKIYVQVE
FT                   DGNGCYNICCLQKNVCEDTPLDIFLMLDNDVKIKTSGSSNEVHIVGYYEVSFGQDNLDE
FT                   DEDEFEDEFDNDEVRMLTKKNTLKNSLSNGISKRKKNLENNEDDETNVGRNDEDDDDED
FT                   DEDDEDEEEDDDEEDEDDEEDDEDDDDEEEEDEEDEDEEGEDEDDEEDEEEEEEEDEEG
FT                   EDVENKKKGGDKKKNKRSLDNKSDGPLKKSKIDDEGQFEKDLVAFLKKNGKSKLTELGK
FT                   VKKPEGLKMKLGFFIKKHSNVFKFDTEGQIVSLK"
     MFYGKVVKPD ETVVPEVKDG YSVIHLSRAC LNNPEHEGKI YVQVEDGNGC YNICCLQKNV        60
     CEDTPLDIFL MLDNDVKIKT SGSSNEVHIV GYYEVSFGQD NLDEDEDEFE DEFDNDEVRM       120
     LTKKNTLKNS LSNGISKRKK NLENNEDDET NVGRNDEDDD DEDDEDDEDE EEDDDEEDED       180
     DEEDDEDDDD EEEEDEEDED EEGEDEDDEE DEEEEEEEDE EGEDVENKKK GGDKKKNKRS       240
     LDNKSDGPLK KSKIDDEGQF EKDLVAFLKK NGKSKLTELG KVKKPEGLKM KLGFFIKKHS       300
     NVFKFDTEGQ IVSLK                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page