(data stored in ACNUC9543 zone)

EMBL: AL844507.PE132

AL844507.PE132       Location/Qualifiers
FT   CDS             complement(665548..667095)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813500"
FT                   /product="PUB domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0813500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0080:mRNA"
FT                   /db_xref="InterPro:IPR018997"
FT                   /db_xref="InterPro:IPR036339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAX1"
FT                   /protein_id="CAD51239.1"
FT                   /translation="MTNVKDVNKNDDHNLSFTDKNKMKKAISVEIEKEHDEKIDLPLKG
FT                   DNMENEKYQQNEQNDGSPKNVESMEALKSSYEKGEFFQKRENEISEENYVTICNKNEIN
FT                   EKKEMNYFKNKIHDDDNNNNNNINVHNTITNKNNSEGTYQLDSNKNIFKNNLYNKNEEE
FT                   NVKHKKENPTFLEIQFKKSLLENENIKRNISAKNFYIIEEDMLINITIILDRIIEQLII
FT                   YYKEKDIDIDEQIVHFQNVFKVLYKLLSNISFHPNEEKYKTIKLRNIQVKNTFLINDDI
FT                   YNLIKLLFDILNFNTDYSYIKLGQDYVNKINVDIINNSECTEFLWKFHKEFNDKDAILF
FT                   EYVLSSVKIIMNSLNKDITYKYSNSIEKNETKKNYQLNIDKYNKTDNLIQDQKRSLENL
FT                   SNIANLSLNNKINIINQKKKEQQQALSDIRKIHNERYKVHKTHGESNTNLMDKNKNKNI
FT                   YNKKNGHLNKNNTHNMYNNNKSYDNEYDHSDNSNDRKNFKNGKKKIKHFFKNFFKKN"
     MTNVKDVNKN DDHNLSFTDK NKMKKAISVE IEKEHDEKID LPLKGDNMEN EKYQQNEQND        60
     GSPKNVESME ALKSSYEKGE FFQKRENEIS EENYVTICNK NEINEKKEMN YFKNKIHDDD       120
     NNNNNNINVH NTITNKNNSE GTYQLDSNKN IFKNNLYNKN EEENVKHKKE NPTFLEIQFK       180
     KSLLENENIK RNISAKNFYI IEEDMLINIT IILDRIIEQL IIYYKEKDID IDEQIVHFQN       240
     VFKVLYKLLS NISFHPNEEK YKTIKLRNIQ VKNTFLINDD IYNLIKLLFD ILNFNTDYSY       300
     IKLGQDYVNK INVDIINNSE CTEFLWKFHK EFNDKDAILF EYVLSSVKII MNSLNKDITY       360
     KYSNSIEKNE TKKNYQLNID KYNKTDNLIQ DQKRSLENLS NIANLSLNNK INIINQKKKE       420
     QQQALSDIRK IHNERYKVHK THGESNTNLM DKNKNKNIYN KKNGHLNKNN THNMYNNNKS       480
     YDNEYDHSDN SNDRKNFKNG KKKIKHFFKN FFKKN                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page