(data stored in ACNUC9543 zone)

EMBL: AL844507.PE139

AL844507.PE139       Location/Qualifiers
FT   CDS             687340..688086
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814200"
FT                   /product="DNA/RNA-binding protein Alba 1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0074:mRNA"
FT                   /db_xref="GOA:Q8IAX8"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAX8"
FT                   /protein_id="CAD51232.1"
FT                   /translation="MKKDREPIDEDEMRITSTGRMTNYVNYGAKILGDEDKKSIKIKAT
FT                   GNAIGKAVTLAEIIKRRFKGLHQITRCGSTVITDQYVSGQDNSEHVVQEKTVSFIEILL
FT                   SREQLDMKDAGYQPPLDEKYVKEMTPEEIVNSRPFRRGGFRPRFYRGFRGGRGGFLRRG
FT                   GYRGFGDRVYEPRSSFRGGRGSGYGGNFGRGGYRSGGGMGGGFRGGFRGGFRGGRDGGY
FT                   RGGNRGGSRSGFRGGRGGFRGGRALS"
     MKKDREPIDE DEMRITSTGR MTNYVNYGAK ILGDEDKKSI KIKATGNAIG KAVTLAEIIK        60
     RRFKGLHQIT RCGSTVITDQ YVSGQDNSEH VVQEKTVSFI EILLSREQLD MKDAGYQPPL       120
     DEKYVKEMTP EEIVNSRPFR RGGFRPRFYR GFRGGRGGFL RRGGYRGFGD RVYEPRSSFR       180
     GGRGSGYGGN FGRGGYRSGG GMGGGFRGGF RGGFRGGRDG GYRGGNRGGS RSGFRGGRGG       240
     FRGGRALS                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page