(data stored in ACNUC9543 zone)

EMBL: AL844507.PE14

AL844507.PE14        Location/Qualifiers
FT   CDS             complement(106593..108242)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801500"
FT                   /product="nucleolar protein 10, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0801500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0135:mRNA"
FT                   /db_xref="GOA:Q8IAL3"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040382"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAL3"
FT                   /protein_id="CAD51350.1"
FT                   /translation="MIKSFINNGITIYSLTSGKLNPENSNNSFGRKNKNFQKDVKNNSV
FT                   EILHDLEFPGKSDEIKISDDGRYFCISGMYPPQVGLYDTKELSIKHRRHFDEEVRTFEF
FT                   LSSNYEKIVFLCKNRYIEFHNAAGKYHKMRIPKEGRNIMYNKENCNLYICGSFDSIYNL
FT                   NLQNGCYENSLKTKNEENNFVCKNPQLPIFCTGGTEGILEIWDERIKKSINFLNMGNEY
FT                   DELTSCSFSDNGLKIAIGSEKGIVKLYDIRHNKPLFIKDHCNDLAINKIEFLKINNNKY
FT                   IYNNIDDNILYNNDNTSCNEFIASCDSNCIKVYSEKKNNLLSLQVINFNDEKKNNSSNK
FT                   KMKLLNNEFININSFTFYKNSGLCFIPCDNKKVFIYFIPIIGIAPEWCNFLDSITEELE
FT                   EKERYKKDDEIDNFSNELFDDYLFITSQQVDQLNINHLKGTKNLIPYLHGYYIPSKVYA
FT                   DIKSVIHETDFETYKKNLIQKKLEQKQQMRIPQKSTLVNKEYVDKLLNKVQKKIDKKQK
FT                   VLVDAQELLEDKRFSKLFYDPEYMVETVHLDE"
     MIKSFINNGI TIYSLTSGKL NPENSNNSFG RKNKNFQKDV KNNSVEILHD LEFPGKSDEI        60
     KISDDGRYFC ISGMYPPQVG LYDTKELSIK HRRHFDEEVR TFEFLSSNYE KIVFLCKNRY       120
     IEFHNAAGKY HKMRIPKEGR NIMYNKENCN LYICGSFDSI YNLNLQNGCY ENSLKTKNEE       180
     NNFVCKNPQL PIFCTGGTEG ILEIWDERIK KSINFLNMGN EYDELTSCSF SDNGLKIAIG       240
     SEKGIVKLYD IRHNKPLFIK DHCNDLAINK IEFLKINNNK YIYNNIDDNI LYNNDNTSCN       300
     EFIASCDSNC IKVYSEKKNN LLSLQVINFN DEKKNNSSNK KMKLLNNEFI NINSFTFYKN       360
     SGLCFIPCDN KKVFIYFIPI IGIAPEWCNF LDSITEELEE KERYKKDDEI DNFSNELFDD       420
     YLFITSQQVD QLNINHLKGT KNLIPYLHGY YIPSKVYADI KSVIHETDFE TYKKNLIQKK       480
     LEQKQQMRIP QKSTLVNKEY VDKLLNKVQK KIDKKQKVLV DAQELLEDKR FSKLFYDPEY       540
     MVETVHLDE                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page