(data stored in ACNUC9543 zone)

EMBL: AL844507.PE142

AL844507.PE142       Location/Qualifiers
FT   CDS             700376..702652
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814500"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.88:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY2"
FT                   /protein_id="CAD51228.1"
FT                   /translation="MDIVRFKEEDTNMLCCESSSNVLDNDCKTFYLLNPDGILDSVAGL
FT                   ENLYISYMNISYKPIICYKCLSFFECENNYNFIRCPKCKIINSVVPHDKLGRKVIIVIC
FT                   YQCNNRNITNIECIYIRCYLCNSLNYSKYSPFNINSTNINIDETKYDTKFNYKDKEKHK
FT                   REQKEKKKNKIKYNNNNNYYFKYNSSNKNKHNYTSKKNKNNMGKKIINLFSLSNMFTCV
FT                   KLPKDDTLTSVISSIGEKEIHSDFRYSRKDSIRSINTENNSIYNRYRINSITSINDNTS
FT                   QHMNNEEKQQNEDFIFHPNDFFNNDNFNNYLYGERLDEEYIYNTNSNNNNNNNNINNNN
FT                   NNINNINNNNNNINNNNNNNNNINNINNNNNNINNNNNNNNSQRKYFSNEPSHGYVPDG
FT                   RFIQDDNRKKFIKTSNNNNNNSYNNYNNYNNYNNYNNYNSNEPFNNEYIRNPTNNYNNI
FT                   NNNYIQKGNNNYIKMNENRNMYMKDNNKGIYNNNNNTMMMNQDYNNYKQNYYTNNQQGS
FT                   WNKDNKIYSSNDYKSNKQDNYYDRIGGLVENGNVKKKAMIFNNMTHDSSSKHHISKNQN
FT                   HLDMEKQKECDVKACIEYFNKLKKGNDINIKTILERGNYKELNIPKEHLENGLFYKNVE
FT                   FYQKHNLKNYVDHYIKPNAVMENKNNMNKDFSKHNSNEYYKNKHLSANNKNKSSDNSNI
FT                   HKSNNKNEEEKNKKNKRSANDLYDTKRANADHDDNINNKKKIKNENARKPTFYTKEELI
FT                   KDFFR"
     MDIVRFKEED TNMLCCESSS NVLDNDCKTF YLLNPDGILD SVAGLENLYI SYMNISYKPI        60
     ICYKCLSFFE CENNYNFIRC PKCKIINSVV PHDKLGRKVI IVICYQCNNR NITNIECIYI       120
     RCYLCNSLNY SKYSPFNINS TNINIDETKY DTKFNYKDKE KHKREQKEKK KNKIKYNNNN       180
     NYYFKYNSSN KNKHNYTSKK NKNNMGKKII NLFSLSNMFT CVKLPKDDTL TSVISSIGEK       240
     EIHSDFRYSR KDSIRSINTE NNSIYNRYRI NSITSINDNT SQHMNNEEKQ QNEDFIFHPN       300
     DFFNNDNFNN YLYGERLDEE YIYNTNSNNN NNNNNINNNN NNINNINNNN NNINNNNNNN       360
     NNINNINNNN NNINNNNNNN NSQRKYFSNE PSHGYVPDGR FIQDDNRKKF IKTSNNNNNN       420
     SYNNYNNYNN YNNYNNYNSN EPFNNEYIRN PTNNYNNINN NYIQKGNNNY IKMNENRNMY       480
     MKDNNKGIYN NNNNTMMMNQ DYNNYKQNYY TNNQQGSWNK DNKIYSSNDY KSNKQDNYYD       540
     RIGGLVENGN VKKKAMIFNN MTHDSSSKHH ISKNQNHLDM EKQKECDVKA CIEYFNKLKK       600
     GNDINIKTIL ERGNYKELNI PKEHLENGLF YKNVEFYQKH NLKNYVDHYI KPNAVMENKN       660
     NMNKDFSKHN SNEYYKNKHL SANNKNKSSD NSNIHKSNNK NEEEKNKKNK RSANDLYDTK       720
     RANADHDDNI NNKKKIKNEN ARKPTFYTKE ELIKDFFR                               758
//

If you have problems or comments...

PBIL Back to PBIL home page