(data stored in ACNUC9543 zone)

EMBL: AL844507.PE143

AL844507.PE143       Location/Qualifiers
FT   CDS             complement(703502..704683)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0073:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY3"
FT                   /protein_id="CAD51227.1"
FT                   /translation="MTNIIECTFKTPPDNAKTPDNAVIWNQFQYCDEKGWYSLSNHDEI
FT                   ALRPTTFNDKRIKFLVQLPEIPSEFESILSGRYDAKAWGKEDCYVVIEGEKDVHIRLPG
FT                   FKEKINYNHTERFPTFLKNWKIIVSILNEHVTLIRINAETALIININEKKNVTVKSVDF
FT                   NNGFLCVNPHTNLAIAYGDFALSSLKKCELIQNIPHEGGKWGFFTHLFKWGHIIIPKEL
FT                   EIKLPSPGLKLIGKKIDTLAIVSIPPNIHIHVKLDGPKCIRKLEYGQDYNITAIKSSES
FT                   DVDIYILFDGHLLKYEFSFDIRLNKPEKGRSLHSAKLKCINKSKEVTSFIFQETKNCKI
FT                   LLGSNCPSDNLGHLLNSQTIAIFDAEIGEYLSHPQGLQLTSVFNTLSYPLDKE"
     MTNIIECTFK TPPDNAKTPD NAVIWNQFQY CDEKGWYSLS NHDEIALRPT TFNDKRIKFL        60
     VQLPEIPSEF ESILSGRYDA KAWGKEDCYV VIEGEKDVHI RLPGFKEKIN YNHTERFPTF       120
     LKNWKIIVSI LNEHVTLIRI NAETALIINI NEKKNVTVKS VDFNNGFLCV NPHTNLAIAY       180
     GDFALSSLKK CELIQNIPHE GGKWGFFTHL FKWGHIIIPK ELEIKLPSPG LKLIGKKIDT       240
     LAIVSIPPNI HIHVKLDGPK CIRKLEYGQD YNITAIKSSE SDVDIYILFD GHLLKYEFSF       300
     DIRLNKPEKG RSLHSAKLKC INKSKEVTSF IFQETKNCKI LLGSNCPSDN LGHLLNSQTI       360
     AIFDAEIGEY LSHPQGLQLT SVFNTLSYPL DKE                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page