(data stored in ACNUC9543 zone)

EMBL: AL844507.PE144

AL844507.PE144       Location/Qualifiers
FT   CDS             706076..706996
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814700"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814700"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0072:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY4"
FT                   /protein_id="CAD51226.1"
FT                   /translation="MSKISKRGEIYFNGFLKYSKKKQKKKPLGNEDVGKIEDIGKTKIT
FT                   DNLKDINSSYSLAQKRKESINMVSKKKKSKNNDIIINDSKKNTNVKSNKNVLKTKLLKK
FT                   SFTPNFEKKTGSIVNNIICDEVPSIHDKGNNTLKKEIRRKTPKMKKKKTNNTLKLSNSS
FT                   RKRSNGLKKRNLNSNKSSTYLNNSYGNLSYFTDYSNYSIRNSSYDIPTSHSKNKNNTKR
FT                   LYVKYKYELPTIASLGKVKKLDYLGLTIDDVELNKKSKKLLYNLSNLYFGNSKLQNSLY
FT                   YHKKSSQVGKKKKEKKKKKNYYTYD"
     MSKISKRGEI YFNGFLKYSK KKQKKKPLGN EDVGKIEDIG KTKITDNLKD INSSYSLAQK        60
     RKESINMVSK KKKSKNNDII INDSKKNTNV KSNKNVLKTK LLKKSFTPNF EKKTGSIVNN       120
     IICDEVPSIH DKGNNTLKKE IRRKTPKMKK KKTNNTLKLS NSSRKRSNGL KKRNLNSNKS       180
     STYLNNSYGN LSYFTDYSNY SIRNSSYDIP TSHSKNKNNT KRLYVKYKYE LPTIASLGKV       240
     KKLDYLGLTI DDVELNKKSK KLLYNLSNLY FGNSKLQNSL YYHKKSSQVG KKKKEKKKKK       300
     NYYTYD                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page