(data stored in ACNUC9543 zone)

EMBL: AL844507.PE147

AL844507.PE147       Location/Qualifiers
FT   CDS             711239..714166
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0815100"
FT                   /product="heptatricopeptide repeat and RAP
FT                   domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0815100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0070:mRNA"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY8"
FT                   /protein_id="CAD51222.1"
FT                   /translation="MIKGDEKRGKKKKKMFHFNNNRIILNSFKKFIRTGKYKDQVINYK
FT                   EIFFEKKEEKNEEDINILKLIHIEDFKICKPKKKSFNKKKIVDKEEEKKEWTPRIIHRK
FT                   DDIKNEERNEHLKLNESNINKEKENYINVGTHHSYNFNKMNSHSTKKCNNYINNNYKNP
FT                   KKNIIYLTNFTVTNSFINKKYYIIKKPKKNSDVEEDELMLHEKRSLELLNKIKWRNEQN
FT                   EDENRIVGNIEKNELYENMNGSFNNLNNGNHSDKKVHLLNSLTFDNKDKIIKKIYKSSI
FT                   NHVRDENLWKKYVQNVFIISSYLDCPDIVILFWCFSKIGYRDNRLVNLLCSIVLKKINE
FT                   LSPCAIALLLNSFKKLEIKKYDTIELLTNQFCFHLSNSTYQDIALVSNSLSFFYIYHKN
FT                   YWKKCILKLQNNSYITCPLHLCLILSAFARLDIREGNILLSFSKVAKRLVPDMSPNNLA
FT                   LIIHSFAKLKFVHPKFFNYLFQHVHKYLDKQLEIIYKVEEKITKGSNNNNNDNNNNDNN
FT                   NDNNNDNNNNNNYYDYDEDALYSKKNKTVIKHCDNYRNNVIINDNVQDKEELNKLDEHL
FT                   SGIKNVEEDKYSKNIMINNNYDAEENCKIIENKKKSYFNKEATAKHTPFVEHNNKNEIS
FT                   ENNNVNHNIKTNNSYINKCSKLNDNKKKMFDLQSLVLLLYSSTCLITCTEQMTLKLIYL
FT                   IMPHKDYLGDHKIDKLKYVSDYLQNLFPSTFETFPKNVKDFFYYIDTYEIKKKKLKYSA
FT                   RWINELSRILTKMNVDHIRNVYINNICTDIMLTSTNVIIKCLGPYSYYINSLVTTSISD
FT                   LKLKILESKKYKVINLSYHDWNKLNDYEEKIKFLYSFGRHAANIFFINNKQESVNEQRN
FT                   NQSISRSQLNKNEKGVQDIDIKLKMNYPHNMKNQNIKSHSQSSIEFDEKIQMDEHFSSD
FT                   EEDEILNFLEKQKGTMDINRNDYNDDIEKIKNYLSFPGGSNGHNA"
     MIKGDEKRGK KKKKMFHFNN NRIILNSFKK FIRTGKYKDQ VINYKEIFFE KKEEKNEEDI        60
     NILKLIHIED FKICKPKKKS FNKKKIVDKE EEKKEWTPRI IHRKDDIKNE ERNEHLKLNE       120
     SNINKEKENY INVGTHHSYN FNKMNSHSTK KCNNYINNNY KNPKKNIIYL TNFTVTNSFI       180
     NKKYYIIKKP KKNSDVEEDE LMLHEKRSLE LLNKIKWRNE QNEDENRIVG NIEKNELYEN       240
     MNGSFNNLNN GNHSDKKVHL LNSLTFDNKD KIIKKIYKSS INHVRDENLW KKYVQNVFII       300
     SSYLDCPDIV ILFWCFSKIG YRDNRLVNLL CSIVLKKINE LSPCAIALLL NSFKKLEIKK       360
     YDTIELLTNQ FCFHLSNSTY QDIALVSNSL SFFYIYHKNY WKKCILKLQN NSYITCPLHL       420
     CLILSAFARL DIREGNILLS FSKVAKRLVP DMSPNNLALI IHSFAKLKFV HPKFFNYLFQ       480
     HVHKYLDKQL EIIYKVEEKI TKGSNNNNND NNNNDNNNDN NNDNNNNNNY YDYDEDALYS       540
     KKNKTVIKHC DNYRNNVIIN DNVQDKEELN KLDEHLSGIK NVEEDKYSKN IMINNNYDAE       600
     ENCKIIENKK KSYFNKEATA KHTPFVEHNN KNEISENNNV NHNIKTNNSY INKCSKLNDN       660
     KKKMFDLQSL VLLLYSSTCL ITCTEQMTLK LIYLIMPHKD YLGDHKIDKL KYVSDYLQNL       720
     FPSTFETFPK NVKDFFYYID TYEIKKKKLK YSARWINELS RILTKMNVDH IRNVYINNIC       780
     TDIMLTSTNV IIKCLGPYSY YINSLVTTSI SDLKLKILES KKYKVINLSY HDWNKLNDYE       840
     EKIKFLYSFG RHAANIFFIN NKQESVNEQR NNQSISRSQL NKNEKGVQDI DIKLKMNYPH       900
     NMKNQNIKSH SQSSIEFDEK IQMDEHFSSD EEDEILNFLE KQKGTMDINR NDYNDDIEKI       960
     KNYLSFPGGS NGHNA                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page