(data stored in ACNUC9543 zone)

EMBL: AL844507.PE148

AL844507.PE148       Location/Qualifiers
FT   CDS             717113..719746
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0815200"
FT                   /product="importin subunit beta, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0815200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0069:mRNA"
FT                   /db_xref="GOA:Q8IAY9"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY9"
FT                   /protein_id="CAD51221.1"
FT                   /translation="MESSNIGQILYATVDPNINIRSEAENKLKLAKESNFVQYINQLSN
FT                   EFCKSENDPYLRQIAGLLIKNAFTSKDNYESEEKARTWLNFPEDIKMELKNNLLVLLSQ
FT                   QSDKIVIGTACQIISIIAKIELSHNKSSELLHKLVNNIIEKNAYTKKSSTVCLAYLTED
FT                   IADVCNESKSKYAFTQPDLDLILTAIINSLCEPAEESTHCANMKVLYNLMSFIEHNFKT
FT                   QVERDIIMKTVIDGCKDTERQSVQIAAYECLINIVSYFYSYLDAYMYAIGPLTWVAIES
FT                   ENERIAISAIEFWNTVCEEETFIDQYELQEGKKNHNIVKQAMVFLLPKIFNAMITQESE
FT                   DIDIDAWTLSMASATFLALSAQLLKNDIVEPVISFVEENFIHEDWRRRDAAVLAYGSIM
FT                   EGPDTEKLKPLVEESVGQLSEVLRDPSVAVRDTAAWTIGKITTYHSEIIYNVLGSYNDS
FT                   NSLYGILLERLNDYPRVAANVCWVFNQLAVNKRTSYNKMTNSYVTDLDDSFCVLCKKLI
FT                   DVSSREDSDIRNLREAAFNALNVVILSVSDNCLKYMIELLSHMMYLLTNTYLNPLTEEV
FT                   KSLQGYYCGTMQFIINRLGNQCKPFLKPIYLSIFRLFEIRTDICEDALLACSAIINVMA
FT                   EDFREHLKTFLNVIFKGLKNVSETSTCKICIEMISDICIPWTSEYEKEMEAILECLWEA
FT                   LKTFGVHDSIKISILTVLGDIATALNRSFSKYLNFFANILSETSKITITSGSPDSDDWV
FT                   NYVFELRDAILLTYSNIIYALIDGNEINKLKPYIPNILDFIELILIKEINHFNAQNFQN
FT                   SVSLLGDLVHAYGYELIENSKLTDLIISVYGKIDILSSQGDEKCETCVSKIKWLKRICN
FT                   ARLSQK"
     MESSNIGQIL YATVDPNINI RSEAENKLKL AKESNFVQYI NQLSNEFCKS ENDPYLRQIA        60
     GLLIKNAFTS KDNYESEEKA RTWLNFPEDI KMELKNNLLV LLSQQSDKIV IGTACQIISI       120
     IAKIELSHNK SSELLHKLVN NIIEKNAYTK KSSTVCLAYL TEDIADVCNE SKSKYAFTQP       180
     DLDLILTAII NSLCEPAEES THCANMKVLY NLMSFIEHNF KTQVERDIIM KTVIDGCKDT       240
     ERQSVQIAAY ECLINIVSYF YSYLDAYMYA IGPLTWVAIE SENERIAISA IEFWNTVCEE       300
     ETFIDQYELQ EGKKNHNIVK QAMVFLLPKI FNAMITQESE DIDIDAWTLS MASATFLALS       360
     AQLLKNDIVE PVISFVEENF IHEDWRRRDA AVLAYGSIME GPDTEKLKPL VEESVGQLSE       420
     VLRDPSVAVR DTAAWTIGKI TTYHSEIIYN VLGSYNDSNS LYGILLERLN DYPRVAANVC       480
     WVFNQLAVNK RTSYNKMTNS YVTDLDDSFC VLCKKLIDVS SREDSDIRNL REAAFNALNV       540
     VILSVSDNCL KYMIELLSHM MYLLTNTYLN PLTEEVKSLQ GYYCGTMQFI INRLGNQCKP       600
     FLKPIYLSIF RLFEIRTDIC EDALLACSAI INVMAEDFRE HLKTFLNVIF KGLKNVSETS       660
     TCKICIEMIS DICIPWTSEY EKEMEAILEC LWEALKTFGV HDSIKISILT VLGDIATALN       720
     RSFSKYLNFF ANILSETSKI TITSGSPDSD DWVNYVFELR DAILLTYSNI IYALIDGNEI       780
     NKLKPYIPNI LDFIELILIK EINHFNAQNF QNSVSLLGDL VHAYGYELIE NSKLTDLIIS       840
     VYGKIDILSS QGDEKCETCV SKIKWLKRIC NARLSQK                                877
//

If you have problems or comments...

PBIL Back to PBIL home page