(data stored in ACNUC9543 zone)

EMBL: AL844507.PE15

AL844507.PE15        Location/Qualifiers
FT   CDS             complement(109180..109557)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0801600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0134:mRNA"
FT                   /db_xref="GOA:Q8IAL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAL4"
FT                   /protein_id="CAD51349.1"
FT                   /translation="MDINLEERSYTSPLLYYIYNKDDKINRISPGEMKNKSFIPYSIRL
FT                   CNLPIKNTKDNSYMSNINSLNIINMLPLSLFSNYNSNNMTSTDILFLPKFSTFLFFTIP
FT                   IFVMLPNLTLYTKHWFFYAPK"
     MDINLEERSY TSPLLYYIYN KDDKINRISP GEMKNKSFIP YSIRLCNLPI KNTKDNSYMS        60
     NINSLNIINM LPLSLFSNYN SNNMTSTDIL FLPKFSTFLF FTIPIFVMLP NLTLYTKHWF       120
     FYAPK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page