(data stored in ACNUC9543 zone)

EMBL: AL844507.PE152

AL844507.PE152       Location/Qualifiers
FT   CDS             complement(join(729917..729946,730071..730182,
FT                   730354..730421,730587..730643,730779..730844,
FT                   730965..731138,731363..731455,731631..731764,
FT                   731943..732002,732175..732187))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0815600"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit G, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0815600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.83:mRNA"
FT                   /db_xref="GOA:Q8IAZ3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017334"
FT                   /db_xref="InterPro:IPR034240"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAZ3"
FT                   /protein_id="CAD51217.2"
FT                   /translation="MIQTEKKWADIDVDDDESINDNEIKKKWEDIDADDDLEANKKLSY
FT                   FTNYENGIKVVTKYSENLKKQTVKVTKKIQEVVIKKKLNKEINNRLNLKNFNIDIHSSV
FT                   TVEPTDVVNIEVPKNNPLDFLKDTEYDYLFAEQTNKTAKDLKNRFKILKDEETEDVKAE
FT                   DPSKAAGRREGLYYRPHDTQNKECTVRVTNLSEDVNENELSNLFGKVGNIVRMFLAKHK
FT                   ETQNSKGFAFITYSKREEAKRAIEKLNRHGFENLLLSVEWAKPSNR"
     MIQTEKKWAD IDVDDDESIN DNEIKKKWED IDADDDLEAN KKLSYFTNYE NGIKVVTKYS        60
     ENLKKQTVKV TKKIQEVVIK KKLNKEINNR LNLKNFNIDI HSSVTVEPTD VVNIEVPKNN       120
     PLDFLKDTEY DYLFAEQTNK TAKDLKNRFK ILKDEETEDV KAEDPSKAAG RREGLYYRPH       180
     DTQNKECTVR VTNLSEDVNE NELSNLFGKV GNIVRMFLAK HKETQNSKGF AFITYSKREE       240
     AKRAIEKLNR HGFENLLLSV EWAKPSNR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page