(data stored in ACNUC9543 zone)

EMBL: AL844507.PE158

AL844507.PE158       Location/Qualifiers
FT   CDS             complement(750082..750711)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816200"
FT                   /product="vacuolar protein sorting-associated protein 2,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0064:mRNA"
FT                   /db_xref="GOA:Q8IAZ9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAZ9"
FT                   /protein_id="CAD51211.1"
FT                   /translation="MGTYFSKDLQECLREEKRNLNRSIRELEREIFKMENEKKQIEKNI
FT                   RIHAKKNDITLVRTLAKDLVKIKQNVIKYNKIKSHLLSMKIKLQSVKSSEQLNKSLCDI
FT                   NNIIKRVNKYIQVKNINNSIYEFQKQNNEVSIKEDMIDDLFDTLNYDIDMIQEEDEIVS
FT                   KVLDELGIQLNSKLEQIPTIKQTENEQLDNVNISKIEDRINNLKKM"
     MGTYFSKDLQ ECLREEKRNL NRSIRELERE IFKMENEKKQ IEKNIRIHAK KNDITLVRTL        60
     AKDLVKIKQN VIKYNKIKSH LLSMKIKLQS VKSSEQLNKS LCDINNIIKR VNKYIQVKNI       120
     NNSIYEFQKQ NNEVSIKEDM IDDLFDTLNY DIDMIQEEDE IVSKVLDELG IQLNSKLEQI       180
     PTIKQTENEQ LDNVNISKIE DRINNLKKM                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page