(data stored in ACNUC9543 zone)

EMBL: AL844507.PE159

AL844507.PE159       Location/Qualifiers
FT   CDS             complement(join(751942..754235,754409..754433,
FT                   754555..754611,754696..754742,754938..755001,
FT                   755091..755122,755223..755345,755497..755716,
FT                   755823..755933,756147..756173))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816300"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.80:mRNA"
FT                   /db_xref="GOA:C0H4U8"
FT                   /db_xref="InterPro:IPR018928"
FT                   /db_xref="InterPro:IPR040326"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U8"
FT                   /protein_id="CAX64125.1"
FT                   /translation="MDRLNKYLSRQKYVVRRSEGSPYRNFLLYVEEIYQVTVVYPIKYL
FT                   FDIPLKYYEYFKSYKKKDIDNKNLKQFCNIIKEQHEINNEQQKCFCCYCRQDDMVFPLF
FT                   SHFNYKKAKFKCNKKEQEEDIVLTLSCLKKKDKIFHSFFIQQNYNFFMLNVTLQQFDLN
FT                   DEYFININDKSTLERKTYLLDSSNYEIDDEVFNVKIKFNVQKNYRNDDIEGNYLFVDSN
FT                   IFKDRIILEDSFKDGDILKNSVIVKSHHVDEHGLTCNKIIGYPIYWNRGKGLCRLKRNE
FT                   CFHKQVSTFLNLEKKLSSKNNMSYNYSFFMIRKLHMDEYNEIDEGFEKTNEYIYNINKL
FT                   NKINEIIDDYKYNNTDRYKYDIKIDNNENLLEYIKNNYYIGLQKERHHFIDIKSHNEEI
FT                   LNISYDEEGIGESVSFVHILSNCYNYNNEKKNISCSIYISIWNEEDIEKEINVFIKCKQ
FT                   RIVNDITQLNKKLFLCKKCEETILIKFEPIYNMLLASCHVLITKEERNLDIKNIYEDPN
FT                   IRGANYKEQHFLFVKDEENVEASHNYKYKKGKYKTYDYDDDMVNMDQRVQNKEYHKIDK
FT                   IYNNNNNNNNDNIYHKNVYIIKEVPLKFDEQFYRPNDHNIMLLYNTMNFVENVEDYILR
FT                   YKRKFFFFINKSGNIVKIILFLFLVIILCIFIIPSLPFCTYFFIKLKWFHKLKTIRLLI
FT                   LWKVQDTFTFFKKIPRKVWRFIKKIAKKCKRVLFKIFIKYKKDQELIDQEYKEKLQRKR
FT                   KKERKKKQIRKKYQLQKKEKEILRKKRYKKLIENEKIFQKEMKKELMHKRNNKIKHENK
FT                   HEENYYINNKNDHTYGHKSKTQKHYKKYHDKYEDKYHHKYHKKEPKQKNIYNHLNNPHN
FT                   PSYNDLEKNQSLTSNTNSSQEYYEKKKYENTLSSAEHINIKNTHHKSKLNTFNNKNTYD
FT                   NQYIKKEPYDKDNIYSDFYAIKNNDQQSILQEKKKNRRSISNISKIYKNNDTIQLSNKD
FT                   SKTSRKDLLP"
     MDRLNKYLSR QKYVVRRSEG SPYRNFLLYV EEIYQVTVVY PIKYLFDIPL KYYEYFKSYK        60
     KKDIDNKNLK QFCNIIKEQH EINNEQQKCF CCYCRQDDMV FPLFSHFNYK KAKFKCNKKE       120
     QEEDIVLTLS CLKKKDKIFH SFFIQQNYNF FMLNVTLQQF DLNDEYFINI NDKSTLERKT       180
     YLLDSSNYEI DDEVFNVKIK FNVQKNYRND DIEGNYLFVD SNIFKDRIIL EDSFKDGDIL       240
     KNSVIVKSHH VDEHGLTCNK IIGYPIYWNR GKGLCRLKRN ECFHKQVSTF LNLEKKLSSK       300
     NNMSYNYSFF MIRKLHMDEY NEIDEGFEKT NEYIYNINKL NKINEIIDDY KYNNTDRYKY       360
     DIKIDNNENL LEYIKNNYYI GLQKERHHFI DIKSHNEEIL NISYDEEGIG ESVSFVHILS       420
     NCYNYNNEKK NISCSIYISI WNEEDIEKEI NVFIKCKQRI VNDITQLNKK LFLCKKCEET       480
     ILIKFEPIYN MLLASCHVLI TKEERNLDIK NIYEDPNIRG ANYKEQHFLF VKDEENVEAS       540
     HNYKYKKGKY KTYDYDDDMV NMDQRVQNKE YHKIDKIYNN NNNNNNDNIY HKNVYIIKEV       600
     PLKFDEQFYR PNDHNIMLLY NTMNFVENVE DYILRYKRKF FFFINKSGNI VKIILFLFLV       660
     IILCIFIIPS LPFCTYFFIK LKWFHKLKTI RLLILWKVQD TFTFFKKIPR KVWRFIKKIA       720
     KKCKRVLFKI FIKYKKDQEL IDQEYKEKLQ RKRKKERKKK QIRKKYQLQK KEKEILRKKR       780
     YKKLIENEKI FQKEMKKELM HKRNNKIKHE NKHEENYYIN NKNDHTYGHK SKTQKHYKKY       840
     HDKYEDKYHH KYHKKEPKQK NIYNHLNNPH NPSYNDLEKN QSLTSNTNSS QEYYEKKKYE       900
     NTLSSAEHIN IKNTHHKSKL NTFNNKNTYD NQYIKKEPYD KDNIYSDFYA IKNNDQQSIL       960
     QEKKKNRRSI SNISKIYKNN DTIQLSNKDS KTSRKDLLP                              999
//

If you have problems or comments...

PBIL Back to PBIL home page