(data stored in ACNUC9543 zone)

EMBL: AL844507.PE162

AL844507.PE162       Location/Qualifiers
FT   CDS             complement(762118..765330)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816600"
FT                   /product="chaperone protein ClpB1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0063:mRNA"
FT                   /db_xref="GOA:Q8IB03"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="PDB:2P65"
FT                   /db_xref="PDB:4XBI"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB03"
FT                   /protein_id="CAD51207.1"
FT                   /translation="MVNSFFFCFVIIGLIYVWDITYSKKAKIFFNKNDIFSIKNTHWDI
FT                   YDKKKYFFIGNNHLKNEESFLPEVRKDYKSQIKEYKNSTNGIIYHNNKNRLSYTINDQV
FT                   NYDNNMTSGINKKRKVKDSSIHMNNSYEKNRNKNKFALFMSDEEYTINSDDYTEKAWEA
FT                   ISSLNKIGEKYDSAYVEAEMLLLALLNDSPDGLAERILKESGIDTQLLVQEIDDYLKKQ
FT                   PKMPSGFGEQKILGRTLQTVLSTSKRLKKEFNDEYISIEHLLLSIISEDSKFTRPWLLK
FT                   YNVNYEKVKKAVEKIRGKKKVTSKTPEMTYQALEKYSRDLTALARAGKLDPVIGRDNEI
FT                   RRAIQILSRRTKNNPILLGDPGVGKTAIVEGLAIKIVQGDVPDSLKGRKLVSLDMSSLI
FT                   AGAKYRGDFEERLKSILKEVQDAEGQVVMFIDEIHTVVGAGAVAEGALDAGNILKPMLA
FT                   RGELRCIGATTVSEYRQFIEKDKALERRFQQILVEQPSVDETISILRGLKERYEVHHGV
FT                   RILDSALVQAAVLSDRYISYRFLPDKAIDLIDEAASNLKIQLSSKPIQLENIEKQLIQL
FT                   EMEKISILGDKQKNLFNYSSVANTHNNNNNSSISSNNSSSYGNAEETEATVDYTKSPNF
FT                   LKKRINEKEIDRLKMIDRIMSELRKEQRKILDSWSTEKSYVDNIRAIKERIDVVKIEIE
FT                   KAERYFDLNRAAELRFETLPDLEKQLKKAEENYLNDIPEKSRILKDEVTSEDIVNIVSM
FT                   STGIRLNKLLKSEKEKILNLENELHKQIIGQDDAVKVVTKAVQRSRVGMNNPKRPIASL
FT                   MFLGPTGVGKTELSKVLADVLFDTPEAVIHFDMSEYMEKHSISKLIGAAPGYVGYEQGG
FT                   LLTDAVRKKPYSIILFDEIEKAHPDVYNLLLRVIDEGKLSDTKGNVANFRNTIIIFTSN
FT                   LGSQSILDLANDPNKKEKIKEQVMKSVRETFRPEFYNRIDDHVIFDSLSKKELKEIANI
FT                   EIRKVANRLFDKNFKITIDDAVFSYIVDKAYDPSFGARPLKRVIQSEIETEIAVRILDE
FT                   TFVENDTINISLKDQKLHFSKS"
     MVNSFFFCFV IIGLIYVWDI TYSKKAKIFF NKNDIFSIKN THWDIYDKKK YFFIGNNHLK        60
     NEESFLPEVR KDYKSQIKEY KNSTNGIIYH NNKNRLSYTI NDQVNYDNNM TSGINKKRKV       120
     KDSSIHMNNS YEKNRNKNKF ALFMSDEEYT INSDDYTEKA WEAISSLNKI GEKYDSAYVE       180
     AEMLLLALLN DSPDGLAERI LKESGIDTQL LVQEIDDYLK KQPKMPSGFG EQKILGRTLQ       240
     TVLSTSKRLK KEFNDEYISI EHLLLSIISE DSKFTRPWLL KYNVNYEKVK KAVEKIRGKK       300
     KVTSKTPEMT YQALEKYSRD LTALARAGKL DPVIGRDNEI RRAIQILSRR TKNNPILLGD       360
     PGVGKTAIVE GLAIKIVQGD VPDSLKGRKL VSLDMSSLIA GAKYRGDFEE RLKSILKEVQ       420
     DAEGQVVMFI DEIHTVVGAG AVAEGALDAG NILKPMLARG ELRCIGATTV SEYRQFIEKD       480
     KALERRFQQI LVEQPSVDET ISILRGLKER YEVHHGVRIL DSALVQAAVL SDRYISYRFL       540
     PDKAIDLIDE AASNLKIQLS SKPIQLENIE KQLIQLEMEK ISILGDKQKN LFNYSSVANT       600
     HNNNNNSSIS SNNSSSYGNA EETEATVDYT KSPNFLKKRI NEKEIDRLKM IDRIMSELRK       660
     EQRKILDSWS TEKSYVDNIR AIKERIDVVK IEIEKAERYF DLNRAAELRF ETLPDLEKQL       720
     KKAEENYLND IPEKSRILKD EVTSEDIVNI VSMSTGIRLN KLLKSEKEKI LNLENELHKQ       780
     IIGQDDAVKV VTKAVQRSRV GMNNPKRPIA SLMFLGPTGV GKTELSKVLA DVLFDTPEAV       840
     IHFDMSEYME KHSISKLIGA APGYVGYEQG GLLTDAVRKK PYSIILFDEI EKAHPDVYNL       900
     LLRVIDEGKL SDTKGNVANF RNTIIIFTSN LGSQSILDLA NDPNKKEKIK EQVMKSVRET       960
     FRPEFYNRID DHVIFDSLSK KELKEIANIE IRKVANRLFD KNFKITIDDA VFSYIVDKAY      1020
     DPSFGARPLK RVIQSEIETE IAVRILDETF VENDTINISL KDQKLHFSKS                 1070
//

If you have problems or comments...

PBIL Back to PBIL home page