(data stored in ACNUC9543 zone)

EMBL: AL844507.PE163

AL844507.PE163       Location/Qualifiers
FT   CDS             join(767110..767239,767323..767507,767665..767758,
FT                   767858..767880)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816700"
FT                   /product="trafficking protein particle complex subunit
FT                   2-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.77:mRNA"
FT                   /db_xref="GOA:C0H4V0"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V0"
FT                   /protein_id="CAX64127.1"
FT                   /translation="MSIKSICYLGDNNDILFFYSVEENDEITSRFALYCTLNNIQKIIE
FT                   SNEKKSSEKKYDPYLGYVGINLSLFSSYKNYAYVIKIINLKIILTIDDSKNKYTDDILK
FT                   SIFIKLHKIYADTVCNPFYTDTLETDTFLKKIKKLMETS"
     MSIKSICYLG DNNDILFFYS VEENDEITSR FALYCTLNNI QKIIESNEKK SSEKKYDPYL        60
     GYVGINLSLF SSYKNYAYVI KIINLKIILT IDDSKNKYTD DILKSIFIKL HKIYADTVCN       120
     PFYTDTLETD TFLKKIKKLM ETS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page